DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and Dnajb3

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001102866.1 Gene:Dnajb3 / 680216 RGDID:1594215 Length:241 Species:Rattus norvegicus


Alignment Length:271 Identity:77/271 - (28%)
Similarity:99/271 - (36%) Gaps:123/271 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIQRTANDGEIRKAYHKQALRYHPDKN--KSPQAEEIFKQVAKAYEVLSDKKKRGSYDS 66
            |||::||:.|.|:...|||||.|.||::|||||  ...:||..|||||:|||||||.:||..||.
  Rat     3 DYYEVLGVPRQASAEAIRKAYRKLALKWHPDKNPEHKEEAERRFKQVAQAYEVLSDARKREVYDR 67

  Fly    67 -----------------------------------------------------RNDKGTRRNT-- 76
                                                                 .|..|.||:|  
  Rat    68 CGEVGEVGGGGAAGSPFHDAFQYVFSFRDPAEVFREFFGGHDPFSFDFFGDPLENFFGDRRSTRG 132

  Fly    77 -ANQGS-----------GFGDG--------TAFGSCGGGSGSGS-----GGGSGGGRQNNPRANF 116
             .::||           |||.|        |:||| .|.||..|     |||:.|          
  Rat   133 SRSRGSVPFSTSFTEFPGFGGGFASLDTGFTSFGS-PGNSGLSSFSMSCGGGAAG---------- 186

  Fly   117 GRFFDNSESYSTFFEDIENDFDSDDDVLLGGGAGAPKRRCEQQSPQSSIEHVIYVALED------ 175
                 |.:|.||..|            ::.|.....||..|....:..:|       ||      
  Rat   187 -----NYKSVSTSTE------------IINGKKITTKRIVENGQERVEVE-------EDGELKSL 227

  Fly   176 IANGCNRRMKI 186
            |.||..:.::|
  Rat   228 IINGKEQLLRI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 77/271 (28%)
DnaJ 4..65 CDD:278647 36/62 (58%)
DnaJ_C 163..326 CDD:199909 7/30 (23%)
Dnajb3NP_001102866.1 DnaJ 3..66 CDD:395170 36/62 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347695
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.