DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and Dnajb7

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_067292.2 Gene:Dnajb7 / 57755 MGIID:1914012 Length:312 Species:Mus musculus


Alignment Length:255 Identity:72/255 - (28%)
Similarity:102/255 - (40%) Gaps:76/255 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIQRTANDGEIRKAYHKQALRYHPDKN--KSPQAEEIFKQVAKAYEVLSDKKKRGSYDS 66
            |||::||:||.|:..:|::||.|.||::|||||  ...:||..||:||:||||||:.:||..||.
Mouse     3 DYYEVLGVQRYASPEDIKRAYRKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNVEKRDIYDK 67

  Fly    67 RNDKGTRRNTANQGSG------------------------FGDGTAF-------------GSCGG 94
            ...:|.      .|.|                        ||:...|             .|...
Mouse    68 YGKEGL------DGRGASHLDDEREYRFTFRKADDVFKEIFGERDPFSFHLFEDSLEGLLNSSRS 126

  Fly    95 GSGS-GSGGGSGGGR-QNNPRANFGRFFDNS-ESYSTFFEDIENDFDS---DDD----------- 142
            .||| |.|.||...| .::|..:....:|.. .||.:...:....|.|   ||.           
Mouse   127 PSGSRGRGAGSHVSRAYDHPALSGLSSYDTGYSSYVSLGHEGLTSFSSLALDDSGMGNYIPITPS 191

  Fly   143 --VLLGGGAGAPK---RRCEQQSPQSSIEHVIYVALEDIAN------GCN-RRMKISRAS 190
              |:.|......|   .|.|:::...|  .:|...:..:||      .|| ||...:..|
Mouse   192 GKVINGRNINTKKAFENRQEREAEDDS--ELISFLVNSVANEEHFTDKCNWRRQSFNNYS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 72/255 (28%)
DnaJ 4..65 CDD:278647 33/62 (53%)
DnaJ_C 163..326 CDD:199909 9/35 (26%)
Dnajb7NP_067292.2 DnaJ 3..66 CDD:278647 33/62 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844323
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.