Sequence 1: | NP_572633.1 | Gene: | CG2887 / 31978 | FlyBaseID: | FBgn0030207 | Length: | 342 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_067292.2 | Gene: | Dnajb7 / 57755 | MGIID: | 1914012 | Length: | 312 | Species: | Mus musculus |
Alignment Length: | 255 | Identity: | 72/255 - (28%) |
---|---|---|---|
Similarity: | 102/255 - (40%) | Gaps: | 76/255 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 DYYKILGIQRTANDGEIRKAYHKQALRYHPDKN--KSPQAEEIFKQVAKAYEVLSDKKKRGSYDS 66
Fly 67 RNDKGTRRNTANQGSG------------------------FGDGTAF-------------GSCGG 94
Fly 95 GSGS-GSGGGSGGGR-QNNPRANFGRFFDNS-ESYSTFFEDIENDFDS---DDD----------- 142
Fly 143 --VLLGGGAGAPK---RRCEQQSPQSSIEHVIYVALEDIAN------GCN-RRMKISRAS 190 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2887 | NP_572633.1 | DnaJ | 1..331 | CDD:223560 | 72/255 (28%) |
DnaJ | 4..65 | CDD:278647 | 33/62 (53%) | ||
DnaJ_C | 163..326 | CDD:199909 | 9/35 (26%) | ||
Dnajb7 | NP_067292.2 | DnaJ | 3..66 | CDD:278647 | 33/62 (53%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 272..312 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844323 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.740 |