DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and dnajb13

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001017606.1 Gene:dnajb13 / 572669 ZFINID:ZDB-GENE-040910-4 Length:322 Species:Danio rerio


Alignment Length:332 Identity:116/332 - (34%)
Similarity:176/332 - (53%) Gaps:28/332 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAKAYEVLSDKKKRGSYD 65
            |.:|||.||.|.|.|.|.:|:|||.:.||::||..|...:|.|.|..:|:|::||||.:|:.:||
Zfish     1 MGRDYYAILEINRNAIDADIKKAYRRLALKHHPRSNSHARAAERFNLLAEAFDVLSDPRKKATYD 65

  Fly    66 SRNDKGTRRNTANQGSGFGDGTAFGSCGGGSGSGSGGGSGGGRQNNPRANFGRFFDNSESYSTFF 130
            ...::|.:                |......|......||.....|....|.:||.....::.||
Zfish    66 KFGEEGLK----------------GGIPSELGVNGAWSSGYVYHGNADETFRQFFGGDNPFADFF 114

  Fly   131 EDIENDFDSDDDVLLGGGAGAPKRRCEQQSPQSSIEHVIYVALEDIANGCNRRMKIS-RASGRNG 194
            ....|:.::..:.|.|       |:.:.|.|  .||..:::||||:..||.:::||| |....:|
Zfish   115 TGDGNEVNAAFESLRG-------RKEKLQDP--PIERDLHLALEDLYYGCTKKIKISRRVMNEDG 170

  Fly   195 VDGVQYDRILTVKIPPGCKAGTKICFPNEGIQLPNLEPANVVFIIRDKPHPIFRRDGNNLLYTAE 259
            ......|:|||..:..|...||:|.||.||.|.||..||::||:||.|.||.|.|..::|.||..
Zfish   171 HTSSIRDKILTFTVKAGWNEGTRITFPKEGDQGPNNIPADIVFVIRQKNHPRFVRQNDDLFYTEH 235

  Fly   260 ISLKDALCGLHVMVPTLLGRPMELKTDVGEVISPKSVRRILGYGLPDSINNSRRGSIVVRFSIQF 324
            |||:.||.|..|.|.||.||.:.:  .:.:::.|:..:.:.|.|:|.|.:.|:||.:::||...|
Zfish   236 ISLEKALTGFSVEVETLDGRLLNI--PINDIVHPQYTKVVSGEGMPLSNSPSKRGDLIIRFITHF 298

  Fly   325 PDAISKE 331
            |:.:|.|
Zfish   299 PEKLSAE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 115/330 (35%)
DnaJ 4..65 CDD:278647 28/60 (47%)
DnaJ_C 163..326 CDD:199909 65/163 (40%)
dnajb13NP_001017606.1 DnaJ 1..311 CDD:223560 116/332 (35%)
DnaJ 4..65 CDD:278647 28/60 (47%)
DnaJ_C 138..302 CDD:199909 67/167 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X227
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.