DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and Dnajb2

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_036008391.1 Gene:Dnajb2 / 56812 MGIID:1928739 Length:365 Species:Mus musculus


Alignment Length:109 Identity:25/109 - (22%)
Similarity:39/109 - (35%) Gaps:33/109 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DKNKSPQAEEIFKQVAKAYEVLSDKKKRGSYDSRNDKGTRRNTANQGSGFGDGTAFGSCGGGSGS 98
            |...||:....|.:......:|.: .||..||....:|.                       :|:
Mouse    77 DTRPSPRGAITFLKGGMTRSLLLE-HKREIYDRYGREGL-----------------------TGA 117

  Fly    99 GSG------GGSGGG---RQNNPRANFGRFFDNSESYSTFFEDI 133
            |||      ||:|.|   ...:|...|..||.:.:.:|..|:|:
Mouse   118 GSGPSRSETGGAGPGFTFTFRSPEEVFREFFGSGDPFSELFDDL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 25/109 (23%)
DnaJ 4..65 CDD:278647 7/30 (23%)
DnaJ_C 163..326 CDD:199909
Dnajb2XP_036008391.1 PRK14294 102..>151 CDD:237664 17/71 (24%)
UIM 291..310 CDD:197845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844333
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.