DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and Dnajb8

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_064348.1 Gene:Dnajb8 / 56691 MGIID:1922801 Length:227 Species:Mus musculus


Alignment Length:226 Identity:71/226 - (31%)
Similarity:102/226 - (45%) Gaps:37/226 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIQRTANDGEIRKAYHKQALRYHPDKN--KSPQAEEIFKQVAKAYEVLSDKKKRGSYDS 66
            :||::||:|.:|:..:|:|||.|.|||:|||||  ...:||:.||||::|||||||.|||..||.
Mouse     3 NYYEVLGVQSSASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKQVSEAYEVLSDSKKRSVYDR 67

  Fly    67 RNDKGTRRNTANQGSGFGDGTAFGSCGGGSGSGSGGGSGGGRQNNPRANFGRFFDNSESYSTFFE 131
               .|..|..|..|:.....:.||:              |....||...|..||...:.:|  ||
Mouse    68 ---AGCDRWRAGGGANVPHSSPFGA--------------GYPFRNPEDIFREFFGGLDPFS--FE 113

  Fly   132 DIENDFDSDDDVLLGGGAGAPKRRCEQQSPQSSIEHVIYV----ALEDIANGCNRRMKISRAS-G 191
            ..:..|         .|.|.| ....:..|....|...::    :...:.:|...|...|.|| |
Mouse   114 FWDTPF---------SGRGRP-HGLHRVFPSGFGEFPAFMEALSSFNTLGHGGGSRSTFSSASFG 168

  Fly   192 RNGVDGVQYDRILTVKIPPGCKAGTKICFPN 222
            .:|..|.: ..:.:.::..|.|..||....|
Mouse   169 GSGSSGFK-SVMSSTEMVNGRKVTTKRIIEN 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 71/226 (31%)
DnaJ 4..65 CDD:278647 35/62 (56%)
DnaJ_C 163..326 CDD:199909 14/65 (22%)
Dnajb8NP_064348.1 DnaJ 3..66 CDD:278647 35/62 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844299
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.