DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and dnajb2

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001073462.1 Gene:dnajb2 / 561686 ZFINID:ZDB-GENE-061013-537 Length:389 Species:Danio rerio


Alignment Length:293 Identity:77/293 - (26%)
Similarity:110/293 - (37%) Gaps:91/293 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIQRTANDGEIRKAYHKQALRYHPDKN--KSPQAEEIFKQVAKAYEVLSDKKKRGSYD- 65
            |||.:||:.|:|:..:|:|||.|.||::|||||  ...:||:.||::|:||||||||.||..|| 
Zfish     3 DYYDVLGVSRSASPDDIKKAYRKLALQWHPDKNPDNKEEAEKKFKEIAEAYEVLSDKSKRDDYDR 67

  Fly    66 -SRNDKGTRRNTANQGSGFGDGTAFGSCGGGSGSGSGGGSGGG------RQNNPRANFGRFFDNS 123
             .|:|..:                       |||||.|.....      ...:|...|..||...
Zfish    68 YGRSDMPS-----------------------SGSGSSGSFPDDFPGFTFTFRSPDEVFREFFGGQ 109

  Fly   124 ESYSTFFEDI--------------------------ENDFDSDDDVLLG-GGAGAPKRRCEQQSP 161
            :.::.||:|.                          ..||.|....|.| |..|....:....|.
Zfish   110 DPFADFFDDFPFGGMHSGFHSSSRLGPSRFFSFPSANADFTSFSSSLGGMGSMGGANFKSVSTST 174

  Fly   162 QSSIEHVIYVALEDIANGCNRRMKISRASGRNGVDGVQYDRILTVKIPPGCKAGTKICF------ 220
            :             :.||.....|..|.:|:...: |:.|.:|...:..|.:....:..      
Zfish   175 R-------------VVNGKRLTTKKVRENGQERTE-VEEDGVLKSVLINGVEDEMALALELSRRE 225

  Fly   221 -----PNEGIQLPNLEPANVVFIIRDKPHPIFR 248
                 |.:..| |.|.|.|     ...|:|..|
Zfish   226 QSSEPPRQSHQ-PLLRPNN-----HSSPNPALR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 77/293 (26%)
DnaJ 4..65 CDD:278647 34/62 (55%)
DnaJ_C 163..326 CDD:199909 18/97 (19%)
dnajb2NP_001073462.1 DnaJ 2..>108 CDD:223560 48/127 (38%)
DnaJ 3..66 CDD:278647 34/62 (55%)
UIM 269..285 CDD:280900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589223
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.