DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and dnajc16

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_005166271.1 Gene:dnajc16 / 559762 ZFINID:ZDB-GENE-130530-683 Length:777 Species:Danio rerio


Alignment Length:80 Identity:33/80 - (41%)
Similarity:55/80 - (68%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAKAYEVLSDKKKRGSYDSRN 68
            |.||:||:.|:|:..||:|.|.:.|..:||||||:|:||::|.::.|:||:|::::||.|||...
Zfish    29 DPYKVLGVTRSASQAEIKKVYKRLAKEWHPDKNKNPEAEDMFIKITKSYEILTNEEKRASYDRYG 93

  Fly    69 DKGTRRNTANQGSGF 83
            .....:...::..||
Zfish    94 QTDDTQPYGHRHHGF 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 33/80 (41%)
DnaJ 4..65 CDD:278647 29/60 (48%)
DnaJ_C 163..326 CDD:199909
dnajc16XP_005166271.1 DnaJ 29..90 CDD:278647 29/60 (48%)
TRX_DnaJ 133..242 CDD:239261
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.