DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and DNAJB12

DIOPT Version :10

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001352009.1 Gene:DNAJB12 / 54788 HGNCID:14891 Length:377 Species:Homo sapiens


Alignment Length:83 Identity:40/83 - (48%)
Similarity:54/83 - (65%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAKAYEVLSDKKKRGSYDSR 67
            ||||:|||:.|.|:|.:::|||.:.||::|||||.:|.|.|.||.:..||.|||:.:||..||..
Human   109 KDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQF 173

  Fly    68 NDKGTRRNTANQGSGFGD 85
            .|  .:...|..|.|.||
Human   174 GD--DKSQAARHGHGHGD 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ_bact 4..331 CDD:274090 39/82 (48%)
DNAJB12NP_001352009.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..92
DnaJ_bact 110..>236 CDD:274090 39/82 (48%)
DUF1977 268..366 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.