DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and dnajb6a

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001002353.1 Gene:dnajb6a / 436626 ZFINID:ZDB-GENE-040718-45 Length:316 Species:Danio rerio


Alignment Length:138 Identity:53/138 - (38%)
Similarity:73/138 - (52%) Gaps:22/138 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIQRTANDGEIRKAYHKQALRYHPDKN--KSPQAEEIFKQVAKAYEVLSDKKKRGSYDS 66
            |||::||:|:||:..:|:|||.|.|||:|||||  ....||:.||::::|||||||..||..||.
Zfish     3 DYYQVLGVQKTASPDDIKKAYRKLALRWHPDKNPDNKEDAEKKFKELSEAYEVLSDANKRSLYDR 67

  Fly    67 RNDKGTRRNTANQGSGFGDGTAFGSCGGGSGSGSGGGSGGGRQNNPRANFGRFFDNSESYSTFF- 130
            ...:|.                  :.|||.|.....|.||....||...|..||...:.::.|| 
Zfish    68 YGKEGL------------------TPGGGGGREHHFGGGGFTFRNPEDVFREFFGGQDPFADFFG 114

  Fly   131 -EDIENDF 137
             :...:||
Zfish   115 ADPFGDDF 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 53/138 (38%)
DnaJ 4..65 CDD:278647 34/62 (55%)
DnaJ_C 163..326 CDD:199909
dnajb6aNP_001002353.1 DnaJ 3..66 CDD:278647 34/62 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589220
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.