DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and DNAJB9

DIOPT Version :10

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_036460.1 Gene:DNAJB9 / 4189 HGNCID:6968 Length:223 Species:Homo sapiens


Alignment Length:169 Identity:60/169 - (35%)
Similarity:83/169 - (49%) Gaps:41/169 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAKAYEVLSDKKKRGSYDSR 67
            |.||.|||:.::|::.:|:||:||.|::|||||||||.||..|:::|:|||.|||..:|..||:.
Human    25 KSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTL 89

  Fly    68 NDKGTRRNTANQGSG--------------FGDGTAFGSCGGGSGSGS------------GGGSGG 106
            ...........:|||              |.|   ||..|....:||            .|||..
Human    90 GHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKD---FGFFGQNQNTGSKKRFENHFQTRQDGGSSR 151

  Fly   107 GRQNNPRANF-GRFFDNSESYSTFFEDIE-----NDFDS 139
            .|.:....:| |..||:      .|||:|     :.|||
Human   152 QRHHFQEFSFGGGLFDD------MFEDMEKMFSFSGFDS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ_bact 4..331 CDD:274090 59/168 (35%)
DNAJB9NP_036460.1 type 2 signal-anchor for ER localization 7..23
DnaJ_bact 26..>136 CDD:274090 44/112 (39%)
Divergent targeting domain. /evidence=ECO:0000250|UniProtKB:Q9QYI6 91..223 25/103 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.