DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and P58IPK

DIOPT Version :10

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_649916.1 Gene:P58IPK / 41161 FlyBaseID:FBgn0037718 Length:498 Species:Drosophila melanogaster


Alignment Length:97 Identity:40/97 - (41%)
Similarity:56/97 - (57%) Gaps:5/97 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQ---AEEIFKQVAKAYEVLSDKKKRGSY 64
            :|||||||::|:|:..||.|||.|.|.::|||..:..:   ||:.|..:|.|.|||:|.:||..:
  Fly   395 RDYYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVAEKKFIDIAAAKEVLTDPEKRRQF 459

  Fly    65 DSRNDKGTRRNTANQGSGFGDGTAFGSCGGGS 96
            |  |.:......:||..||.....||....||
  Fly   460 D--NGEDPLDPESNQRGGFHGEHPFGHFQHGS 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ_bact 4..331 CDD:274090 40/96 (42%)
P58IPKNP_649916.1 TPR repeat 43..71 CDD:276809
LapB 47..284 CDD:442196
TPR repeat 76..106 CDD:276809
TPR repeat 111..139 CDD:276809
TPR repeat 190..220 CDD:276809
LapB 196..>378 CDD:442196
TPR repeat 225..253 CDD:276809
TPR repeat 309..337 CDD:276809
TPR repeat 341..371 CDD:276809
TPR repeat 376..399 CDD:276809 2/3 (67%)
PRK14278 395..>485 CDD:237654 38/91 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.