DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and Dph4

DIOPT Version :10

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_649559.1 Gene:Dph4 / 40686 FlyBaseID:FBgn0037350 Length:183 Species:Drosophila melanogaster


Alignment Length:84 Identity:18/84 - (21%)
Similarity:31/84 - (36%) Gaps:14/84 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 QLITIFRLNIARINASVTAASLPLIVECINEWRA-SRREIHGWFFKVPLVDIVRDWNEAEIDWRR 279
            :|:.|....:|.::...|...:||:...:...:: ...|:.  |.|....|:          ||.
  Fly    12 RLLAIASATLAIVSMLATVIIVPLVYNHVQHLQSVMNSEVD--FCKTRSRDL----------WRE 64

  Fly   280 TIT-QRIDGTSRLLMNRRT 297
            .:| |...|.......|||
  Fly    65 MVTVQSATGGIPARTARRT 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ_bact 4..331 CDD:274090 18/84 (21%)
Dph4NP_649559.1 DnaJ 3..72 CDD:395170 14/71 (20%)
zf-CSL <138..179 CDD:398744
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.