DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and CG7130

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_649380.1 Gene:CG7130 / 40450 FlyBaseID:FBgn0037151 Length:128 Species:Drosophila melanogaster


Alignment Length:73 Identity:41/73 - (56%)
Similarity:54/73 - (73%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAKAYEVLSDKKKRGSYD 65
            |.|||||||||:|.|:..:::|.|.:.|||||||||..|||||.|::|..|:|||.||:||..||
  Fly     1 MGKDYYKILGIERNASSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFEVLFDKEKREIYD 65

  Fly    66 SRNDKGTR 73
            ...::|.:
  Fly    66 QHGEEGLK 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 41/73 (56%)
DnaJ 4..65 CDD:278647 36/60 (60%)
DnaJ_C 163..326 CDD:199909
CG7130NP_649380.1 DnaJ 4..65 CDD:278647 36/60 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458959
Domainoid 1 1.000 80 1.000 Domainoid score I3000
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.