powered by:
Protein Alignment CG2887 and CG7130
DIOPT Version :9
Sequence 1: | NP_572633.1 |
Gene: | CG2887 / 31978 |
FlyBaseID: | FBgn0030207 |
Length: | 342 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_649380.1 |
Gene: | CG7130 / 40450 |
FlyBaseID: | FBgn0037151 |
Length: | 128 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 41/73 - (56%) |
Similarity: | 54/73 - (73%) |
Gaps: | 0/73 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MPKDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAKAYEVLSDKKKRGSYD 65
|.|||||||||:|.|:..:::|.|.:.|||||||||..|||||.|::|..|:|||.||:||..||
Fly 1 MGKDYYKILGIERNASSEDVKKGYRRMALRYHPDKNDHPQAEEQFREVVAAFEVLFDKEKREIYD 65
Fly 66 SRNDKGTR 73
...::|.:
Fly 66 QHGEEGLK 73
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45458959 |
Domainoid |
1 |
1.000 |
80 |
1.000 |
Domainoid score |
I3000 |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000274 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.740 |
|
Return to query results.
Submit another query.