DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and dnajb6

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_012819877.1 Gene:dnajb6 / 394712 XenbaseID:XB-GENE-972413 Length:336 Species:Xenopus tropicalis


Alignment Length:220 Identity:64/220 - (29%)
Similarity:82/220 - (37%) Gaps:91/220 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIQRTANDGEIRKAYHKQALRYHPDKN--KSPQAEEIFKQVAKAYEVLSDKKKRGSYD- 65
            :||.:||:||.|:..:|:|||.|.||::|||||  ...:||..||:||:|||||||.|||..|| 
 Frog     3 EYYDVLGVQRNASPEDIKKAYRKLALKWHPDKNPDNKDEAERRFKEVAEAYEVLSDSKKRDIYDK 67

  Fly    66 --------------------------SRND----------------------------KGTRRNT 76
                                      |.:|                            :|.|.|.
 Frog    68 YGKEGLTGGGGGSHFDNPYEFGFTFRSPDDVFRDFFGGRDPFSFDLFADDPFDDFFGRRGHRANR 132

  Fly    77 ANQGSGF-------------------GDGTAFGSCGGGSG-----SGSGGGSGGGR--------- 108
            :..|..|                   |..::|||.||..|     |.|.||||.|.         
 Frog   133 SRPGGSFLSTFGGFPAFGPTFSPFDSGFSSSFGSFGGHGGFSSFSSSSFGGSGMGNFRSVSTSTK 197

  Fly   109 -QNNPRANFGRFFDNSESYSTFFED 132
             .|..|....|..:|.:......||
 Frog   198 VVNGRRVTTKRIVENGQERIEVEED 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 64/220 (29%)
DnaJ 4..65 CDD:278647 35/62 (56%)
DnaJ_C 163..326 CDD:199909
dnajb6XP_012819877.1 DnaJ 3..66 CDD:278647 35/62 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.