Sequence 1: | NP_572633.1 | Gene: | CG2887 / 31978 | FlyBaseID: | FBgn0030207 | Length: | 342 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_012819877.1 | Gene: | dnajb6 / 394712 | XenbaseID: | XB-GENE-972413 | Length: | 336 | Species: | Xenopus tropicalis |
Alignment Length: | 220 | Identity: | 64/220 - (29%) |
---|---|---|---|
Similarity: | 82/220 - (37%) | Gaps: | 91/220 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 DYYKILGIQRTANDGEIRKAYHKQALRYHPDKN--KSPQAEEIFKQVAKAYEVLSDKKKRGSYD- 65
Fly 66 --------------------------SRND----------------------------KGTRRNT 76
Fly 77 ANQGSGF-------------------GDGTAFGSCGGGSG-----SGSGGGSGGGR--------- 108
Fly 109 -QNNPRANFGRFFDNSESYSTFFED 132 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2887 | NP_572633.1 | DnaJ | 1..331 | CDD:223560 | 64/220 (29%) |
DnaJ | 4..65 | CDD:278647 | 35/62 (56%) | ||
DnaJ_C | 163..326 | CDD:199909 | |||
dnajb6 | XP_012819877.1 | DnaJ | 3..66 | CDD:278647 | 35/62 (56%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |