DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and DnaJ-1

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster


Alignment Length:360 Identity:161/360 - (44%)
Similarity:216/360 - (60%) Gaps:44/360 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAKAYEVLSDKKKRGSYD 65
            |.||:|||||::|.|:|.||:|||.|.||:|||||||||||||.||::|:|||||||||||..:|
  Fly     1 MGKDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFD 65

  Fly    66 SRNDKGTRRNTANQGSGFGDGTAFGSCGGGSGSGSGGGSGGGR----QNNPRANFGRFFDNSESY 126
            :..:.|.:                    ||.....|||..|..    ..:|||.|.:||.:|:.:
  Fly    66 NYGEDGLK--------------------GGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPF 110

  Fly   127 STFFEDIENDFDSDD-------------DVLLGGGAGAPKRRCEQQSPQSSIEHVIYVALEDIAN 178
            ..||...:|.|....             |.:....|.||.|:.:|..|   |||.::|:||::..
  Fly   111 GAFFTGGDNMFSGGQGGNTNEIFWNIGGDDMFAFNAQAPSRKRQQDPP---IEHDLFVSLEEVDK 172

  Fly   179 GCNRRMKISR-ASGRNGVDGVQYDRILTVKIPPGCKAGTKICFPNEGIQLPNLEPANVVFIIRDK 242
            ||.::||||| |:|.||  ..:.:::|.:.:.||.||||||.||.||...||..||::|||||||
  Fly   173 GCIKKMKISRMATGSNG--PYKEEKVLRITVKPGWKAGTKITFPQEGDSAPNKTPADIVFIIRDK 235

  Fly   243 PHPIFRRDGNNLLYTAEISLKDALCGLHVMVPTLLGRPMELKTDVGEVISPKSVRRILGYGLPDS 307
            ||.:|:|:|.:|.|||:||||.||||..|.||||.|..:::..: .|:|.|.:.|||.|.|||..
  Fly   236 PHSLFKREGIDLKYTAQISLKQALCGALVSVPTLQGSRIQVNPN-HEIIKPTTTRRINGLGLPVP 299

  Fly   308 INNSRRGSIVVRFSIQFPDAISKELASSLDRLLQN 342
            ...||||.::|.|.|:|||.::..|.:.|..||.|
  Fly   300 KEPSRRGDLIVSFDIKFPDTLAPSLQNQLSELLPN 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 156/347 (45%)
DnaJ 4..65 CDD:278647 44/60 (73%)
DnaJ_C 163..326 CDD:199909 82/163 (50%)
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 159/357 (45%)
DnaJ 4..65 CDD:278647 44/60 (73%)
DnaJ_C 157..320 CDD:199909 85/168 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469064
Domainoid 1 1.000 83 1.000 Domainoid score I435
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 230 1.000 Inparanoid score I863
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101131at50557
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 1 1.000 - - mtm955
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24078
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X227
109.900

Return to query results.
Submit another query.