DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and CG12020

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_647662.1 Gene:CG12020 / 38233 FlyBaseID:FBgn0035273 Length:366 Species:Drosophila melanogaster


Alignment Length:376 Identity:93/376 - (24%)
Similarity:146/376 - (38%) Gaps:90/376 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIQRTANDGEIRKAYHKQALRYHPDKNK------------------SPQAE-EIFKQVA 49
            |||.:|...|.|...:|..||.:.|:|..|.::|                  ||..| ..:..|.
  Fly     7 DYYAVLDQPRGATKEQITLAYRRLAIRLCPHRDKKDEQDFVPLAQEGRLTHLSPMGEPRQWAYVN 71

  Fly    50 KAYEVLSDKKKRGSYDSRNDKGTRRNTANQGSGFGDGTAFGSCGGGSGSGSGGGSGGGRQ--NNP 112
            .|::||.:...|..||                      .||..|...|.....|.....|  .:.
  Fly    72 MAFDVLGNDLYRAIYD----------------------RFGEAGLFEGVMLPNGYFPPYQYDGDH 114

  Fly   113 RANFGRFFDNSESYSTFFEDIENDFDSDDDVLLGGGAGAPKRRCEQQ------SPQSSIEHVIYV 171
            ...:.|.|.:...|:...:.|.|               .|.....:|      |..:|.|.:|.:
  Fly   115 MKVYERVFGSYSPYANVIDAISN---------------PPSLYATRQHGIGVRSKDASTERIIEL 164

  Fly   172 ALEDIANGCNRRMKISRASGRNGVDGVQYDRI------LTVKIPPGCKAGTKICFPNEGIQLPNL 230
            :||::..||.:.|.:.|   :..||..: .|:      |.:.|.||..|||:.||..||.:.|..
  Fly   165 SLEEVRTGCVKLMNVWR---QEIVDAKE-SRLEKRKHTLKLNIAPGTTAGTRFCFKEEGDRYPAT 225

  Fly   231 EPANVVFIIRDKPHPIF-RRDGNNLLYTAEISLKDALCGLHVMVPTLLGRPMELKTDVGEVISPK 294
            .|.:::||..|||||.| ||:.::|:|...|.|..|..|....:.||..|  :||..:.:|:.|.
  Fly   226 IPGDIIFIAADKPHPDFERRNQHDLVYRQSIGLCQAFTGFTFFICTLDRR--QLKVVITDVVQPG 288

  Fly   295 SVRRILGYGLP-----DSINNSRR--------GSIVVRFSIQFPDAISKEL 332
            ..:.:...|||     |::...:.        |.:::.|...||..::..:
  Fly   289 YTKVVPLEGLPKCRNLDAVTAIKEANKKVEQFGDLIIEFDYIFPKYLTPHM 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 93/373 (25%)
DnaJ 4..65 CDD:278647 21/79 (27%)
DnaJ_C 163..326 CDD:199909 55/182 (30%)
CG12020NP_647662.1 DnaJ 7..352 CDD:223560 93/376 (25%)
DnaJ 7..87 CDD:278647 21/79 (27%)
DnaJ_C 156..335 CDD:199909 56/184 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458995
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24078
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.