DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and DnaJ-60

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_523840.1 Gene:DnaJ-60 / 37869 FlyBaseID:FBgn0260775 Length:217 Species:Drosophila melanogaster


Alignment Length:92 Identity:26/92 - (28%)
Similarity:47/92 - (51%) Gaps:10/92 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PKDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKS---PQAEEIFKQVAKAYEVLSDKKKRGS 63
            |:.:|::|.|:...:..|:|.|:.:.:..||||...:   |:....|.|:::||:.|...::|..
  Fly    24 PETHYEVLNIRNDCSTREVRNAFVQLSKLYHPDVKSNAACPERTARFVQISEAYKTLIKPERRRD 88

  Fly    64 YD-------SRNDKGTRRNTANQGSGF 83
            ||       ||:|:.....|.|.|..:
  Fly    89 YDDSLLWQPSRSDRSPVGETVNPGQAW 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 26/92 (28%)
DnaJ 4..65 CDD:278647 17/63 (27%)
DnaJ_C 163..326 CDD:199909
DnaJ-60NP_523840.1 DnaJ 26..90 CDD:278647 17/63 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.