DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and mrj

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001246364.1 Gene:mrj / 36797 FlyBaseID:FBgn0034091 Length:346 Species:Drosophila melanogaster


Alignment Length:244 Identity:80/244 - (32%)
Similarity:110/244 - (45%) Gaps:65/244 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKS--PQAEEIFKQVAKAYEVLSDKKKRGSYDS 66
            ||||||.:.|:|.|.|::|||.|.||::|||||..  .:|.:.|:::::|||||||.:||..||:
  Fly     3 DYYKILDVSRSATDSEVKKAYRKLALKWHPDKNPDNLDEANKRFRELSEAYEVLSDARKRRIYDA 67

  Fly    67 RNDKGTRRNTANQGSGFGDGTAF-----GSCGGGSG----------SGSGGGSGGGRQNNPR--- 113
            |   .|...::|.||...:.:::     |..||.|.          .|||.|||.||::..|   
  Fly    68 R---ATLHKSSNSGSSSSNSSSYTRYRNGGTGGSSSYGRDYDYDYYPGSGYGSGSGRRSGNRYQA 129

  Fly   114 ---------ANFGRFF----------------DNSES-------YSTFFEDIENDFDSDDDVLLG 146
                     ..|.:.|                |..:|       |||      :||| |.|:|  
  Fly   130 FTFRNIFEGTPFHKMFEKKRRIYDEYGKDGLGDRGQSRSHARHHYST------HDFD-DFDIL-- 185

  Fly   147 GGAGAPKRRCEQQSPQSSIEHVIYVALEDIANG-CNRRMKISRASGRNG 194
            ||.....|..|:...:....|..:..|...||| .|.....|..|.|||
  Fly   186 GGFQFAFRPPEEVFREFFGIHSPFADLFRDANGHSNGSTSGSSGSRRNG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 80/244 (33%)
DnaJ 4..65 CDD:278647 32/62 (52%)
DnaJ_C 163..326 CDD:199909 11/33 (33%)
mrjNP_001246364.1 DnaJ 2..>66 CDD:223560 32/62 (52%)
DnaJ 3..66 CDD:278647 32/62 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458989
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.