powered by:
Protein Alignment CG2887 and Dnajc5g
DIOPT Version :9
Sequence 1: | NP_572633.1 |
Gene: | CG2887 / 31978 |
FlyBaseID: | FBgn0030207 |
Length: | 342 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017449734.1 |
Gene: | Dnajc5g / 366567 |
RGDID: | 1307426 |
Length: | 186 |
Species: | Rattus norvegicus |
Alignment Length: | 70 |
Identity: | 31/70 - (44%) |
Similarity: | 42/70 - (60%) |
Gaps: | 1/70 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNK-SPQAEEIFKQVAKAYEVLSDKKKRGSYDS 66
|..|.:|.:::.|...||:|||.|.||:||||||. :.||.|.||.:..|:.||:|..|:..||.
Rat 16 KSLYAVLELKKGAQPEEIKKAYRKLALQYHPDKNPGNSQAAEFFKDINAAHAVLTDPTKKKIYDR 80
Fly 67 RNDKG 71
....|
Rat 81 HGSLG 85
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG2887 | NP_572633.1 |
DnaJ |
1..331 |
CDD:223560 |
31/70 (44%) |
DnaJ |
4..65 |
CDD:278647 |
27/61 (44%) |
DnaJ_C |
163..326 |
CDD:199909 |
|
Dnajc5g | XP_017449734.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.