DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and Dnajc11

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001102164.1 Gene:Dnajc11 / 362666 RGDID:1307731 Length:559 Species:Rattus norvegicus


Alignment Length:340 Identity:73/340 - (21%)
Similarity:126/340 - (37%) Gaps:100/340 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSP----QAEEIFKQVAKAYEVLSDKKKRGS 63
            :|||.:|.::|.|:..|::.||.:..:.|||||::.|    |||.:|..|.:|||||||.:.|..
  Rat    13 EDYYSLLNVRREASAEELKAAYRRLCMLYHPDKHRDPELKSQAERLFNLVHQAYEVLSDPQTRAI 77

  Fly    64 YDSRNDKG----------TRRNTANQGSGFGDGTAFGSCGGGSGSGSGGGSGGGR---------- 108
            ||....:|          .:|..|.....|                       .|          
  Rat    78 YDIYGKRGLEMEGWEVVERKRTPAEIREEF-----------------------ERLQREREERKL 119

  Fly   109 --QNNPRANFGRFFDNSESYSTFFEDIENDFDSDDDVLLGGGAGAPKRRCEQQSPQSSIEHVIYV 171
              :.||:.......|.::.:..:.|:.|       ||   .|:|.|:....:.....|||..:..
  Rat   120 QQRTNPKGTISVGVDATDLFDRYDEEYE-------DV---SGSGFPQIEINKMHISQSIEAPLTA 174

  Fly   172 ALEDIANGCNRRMKISRASGRNGVDGVQYDRILTVKIPPGCKAGTKICFPNEGIQLPNLEPANVV 236
            ....|.:|     .:|..:| ||...:.:    .::.....|...::.|....:|.|       :
  Rat   175 TDTAILSG-----SLSTQNG-NGGGSINF----ALRRVTSAKGWGELEFGAGDLQGP-------L 222

  Fly   237 FIIRDKPHPIFRRDGNNLLYTAEISLKDALCGLHVMVPTLLGRPMELKTDVGEVISPKSVRRILG 301
            |.::     :||........|...:|:.:..|:...:.|:|.|.::..|              :|
  Rat   223 FGLK-----LFRNLTPRCFVTTNCALQFSSRGIRPGLTTVLARNLDKNT--------------VG 268

  Fly   302 Y-----GLPDSINNS 311
            |     |:..::|.|
  Rat   269 YLQWRWGIQSAMNTS 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 73/340 (21%)
DnaJ 4..65 CDD:278647 28/64 (44%)
DnaJ_C 163..326 CDD:199909 28/154 (18%)
Dnajc11NP_001102164.1 DnaJ 14..79 CDD:278647 28/64 (44%)
Selenoprotein_S 372..>447 CDD:284376
DUF3395 417..549 CDD:288708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.