DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and Dnajb6

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_006235925.1 Gene:Dnajb6 / 362293 RGDID:1308207 Length:364 Species:Rattus norvegicus


Alignment Length:140 Identity:61/140 - (43%)
Similarity:75/140 - (53%) Gaps:25/140 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIQRTANDGEIRKAYHKQALRYHPDKN--KSPQAEEIFKQVAKAYEVLSDKKKRGSYDS 66
            |||::||:||.|:..:|:|||.||||::|||||  ...:||..|||||:|||||||.|||..||.
  Rat     3 DYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDK 67

  Fly    67 RNDKGTRRNTANQGSGFGDGTAFGSCGGGSGSGSGGGSG---GGRQNNPRANFGRFFDNSESYS- 127
            ...:|..                   |||.|.||...|.   |....||...|..||...:.:| 
  Rat    68 YGKEGLN-------------------GGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDPFSF 113

  Fly   128 TFFEDIENDF 137
            .||||..:||
  Rat   114 DFFEDPFDDF 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 61/140 (44%)
DnaJ 4..65 CDD:278647 38/62 (61%)
DnaJ_C 163..326 CDD:199909
Dnajb6XP_006235925.1 DnaJ 2..>107 CDD:223560 54/122 (44%)
DnaJ 3..66 CDD:278647 38/62 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347711
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.