DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and Dnajc24

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001178782.1 Gene:Dnajc24 / 362184 RGDID:1564710 Length:148 Species:Rattus norvegicus


Alignment Length:110 Identity:28/110 - (25%)
Similarity:52/110 - (47%) Gaps:18/110 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKS-------PQAEEIFKQVAKAYEVLSDKKK 60
            ||:|.|||...:|:..::::.|.|..|.|||||..:       .:..:.|.::.:|:::|.:::.
  Rat     9 KDWYSILGADPSADVSDLKQKYQKLILLYHPDKQSADVPAGTMEECVQKFIEIDQAWKILGNEET 73

  Fly    61 RGSYDSRNDKGTRRNTA--------NQGSGFGDGTAFG---SCGG 94
            :..||.:..:...||..        .:.|...|..:|.   .|||
  Rat    74 KKKYDLQRHEDELRNVGPVDAQVHLEEMSWNKDEESFSLSCRCGG 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 28/110 (25%)
DnaJ 4..65 CDD:278647 17/67 (25%)
DnaJ_C 163..326 CDD:199909
Dnajc24NP_001178782.1 DnaJ 10..78 CDD:395170 17/67 (25%)
zf-CSL 94..147 CDD:398744 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.