DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and Dnajb1

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001382078.1 Gene:Dnajb1 / 361384 RGDID:1304725 Length:340 Species:Rattus norvegicus


Alignment Length:363 Identity:145/363 - (39%)
Similarity:204/363 - (56%) Gaps:48/363 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAKAYEVLSDKKKRGSYD 65
            |.||||:.||:.|.|:|.||::||.:|||||||||||.|.|||.||::|:||:||||.:||..:|
  Rat     1 MGKDYYQTLGLARGASDDEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFD 65

  Fly    66 SRNDKGTRRNTANQGSGFGDGTAFGSCGGGSGSGSGGGSGGGR-----QNNPRANFGRFFDNSES 125
            ...::|.:                   |||...||.||:.|..     ..:|.|.|..||.....
  Rat    66 RYGEEGLK-------------------GGGPSGGSSGGANGTSFSYTFHGDPHAMFAEFFGGRNP 111

  Fly   126 YSTFF--EDIENDFDSDD-----DVLLGG------GAGAPKRRCEQQSPQSSIEHVIYVALEDIA 177
            :.|||  .:.|...|.||     .:.:||      |...|.:...::.....:.|.:.|:||:|.
  Rat   112 FDTFFGQRNGEEGMDIDDPFSSFPMGMGGFTNMNFGRSRPTQEPTRKKQDPPVTHDLRVSLEEIY 176

  Fly   178 NGCNRRMKISRASGRNGVDGVQY---DRILTVKIPPGCKAGTKICFPNEGIQLPNLEPANVVFII 239
            :||.::||||..  |...||...   |:|||:::..|.|.||||.||.||.|..|..||::||::
  Rat   177 SGCTKKMKISHK--RLNPDGKSIRNEDKILTIEVKRGWKEGTKITFPKEGDQTSNNIPADIVFVL 239

  Fly   240 RDKPHPIFRRDGNNLLYTAEISLKDALCGLHVMVPTLLGR--PMELKTDVGEVISPKSVRRILGY 302
            :||||.||:|||::::|.|.|||::||||..|.||||.||  |:..|    :||.|...|::.|.
  Rat   240 KDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFK----DVIRPGMRRKVPGE 300

  Fly   303 GLPDSINNSRRGSIVVRFSIQFPDAISKELASSLDRLL 340
            |||......:||.:|:.|.:.|||.|.....:.|:::|
  Rat   301 GLPLPKTPEKRGDLVIEFEVIFPDRIPISSRTILEQVL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 143/352 (41%)
DnaJ 4..65 CDD:278647 38/60 (63%)
DnaJ_C 163..326 CDD:199909 74/167 (44%)
Dnajb1NP_001382078.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347667
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X227
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.