DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and Dnajb11

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001015021.1 Gene:Dnajb11 / 360734 RGDID:1307373 Length:358 Species:Rattus norvegicus


Alignment Length:365 Identity:105/365 - (28%)
Similarity:164/365 - (44%) Gaps:70/365 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGIQRTANDGEIRKAYHKQALRYHPDKN-KSPQAEEIFKQVAKAYEVLSDKKKRGSYDS 66
            :|:|||||:.|:|:..:|:|||.|.||:.|||:| ..|||:|.|:.:..|||||||.:||..||:
  Rat    24 RDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQYDT 88

  Fly    67 RNDKGTRRNTANQGSGFGDGTAFGSCGGGSGSGSGGGSGGGRQNNPRANFGRFFDNSESYSTFFE 131
            ..::|.:     .|.....|..|....|..|...||......:|.||.            |....
  Rat    89 YGEEGLK-----DGHQSSHGDIFSHFFGDFGFMFGGAPRQQDRNIPRG------------SDIIV 136

  Fly   132 DIENDFDSDDDVLLGG----------GAGAP-KRRCEQQSPQSSIEHVIYVALEDIANGCNRRMK 185
            |:|...   ::|..|.          ...|| ||:|                      .|.:.|:
  Rat   137 DLEVTL---EEVYAGNFVEVVRNKPVARQAPGKRKC----------------------NCRQEMR 176

  Fly   186 ISR-ASGR------------NGVDGVQYDRILTVKIPPGCKAGTKICFPNEGIQLPNLEPANVVF 237
            .:: ..||            ..|..|..:|.|.|:|.||.:.|.:..|..||....:.||.::.|
  Rat   177 TTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDLRF 241

  Fly   238 IIRDKPHPIFRRDGNNLLYTAEISLKDALCGLHVMVPTLLGRPMELKTDVGEVISPKSVRRILGY 302
            .|:...|.||.|.|::|.....:||.:||.|..:.:..|.|..:.:..|  ::..|.:.....|.
  Rat   242 RIKVVKHRIFERRGDDLYTNVTVSLVEALVGFEMDITHLDGHKVHISRD--KITRPGAKLWKKGE 304

  Fly   303 GLPDSINNSRRGSIVVRFSIQFP-DAISKELASSLDRLLQ 341
            |||:..||:.:||:::.|.:.|| :.:::|....:.:||:
  Rat   305 GLPNFDNNNIKGSLIITFDVDFPKEQLTEEAKEGIKQLLK 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 102/353 (29%)
DnaJ 4..65 CDD:278647 33/61 (54%)
DnaJ_C 163..326 CDD:199909 46/176 (26%)
Dnajb11NP_001015021.1 DnaJ 22..344 CDD:223560 104/363 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.