DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and Dnaja3

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001033684.2 Gene:Dnaja3 / 360481 RGDID:1306527 Length:480 Species:Rattus norvegicus


Alignment Length:384 Identity:105/384 - (27%)
Similarity:159/384 - (41%) Gaps:99/384 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIQRTANDGEIRKAYHKQALRYHPDKNK-SPQAEEIFKQVAKAYEVLSDKKKRGSYDSR 67
            |||:|||:.|.|:..:|:|||::.|.:||||.|| .|:|:|.|.|:|:|||||||:.||..||  
  Rat    93 DYYQILGVPRNASQKDIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYD-- 155

  Fly    68 NDKGTRRNTANQGSGFGDGTAFGSCG---GGSGSGSGGGSGGGRQNNPRANFGRFFDNSESYSTF 129
                                |:||.|   |.|.||.|... ||...:|...|.:.|  .|..|:.
  Rat   156 --------------------AYGSAGFDPGASSSGQGYWR-GGPSVDPEELFRKIF--GEFSSSP 197

  Fly   130 FEDIENDFDSDDDVLL-----GGGAGAPK----------RRCEQQ--SPQSSIEHVIYVA---LE 174
            |.|.:|.||...:.::     ....|..|          .||:.:  .|.:.::|..|.:   :|
  Rat   198 FGDFQNVFDQPQEYIMELTFNQAAKGVNKEFTVNIMDTCERCDGKGNEPGTKVQHCHYCSGSGME 262

  Fly   175 DIANG-CNRRMKISRASGR-----------NGVDGVQYDRILTVKIPPGCKAGTKICFPNEGIQL 227
            .|..| ...|....|..||           .|....:..:.:||.:|.|.:.|..:..|      
  Rat   263 TINTGPFVMRSTCRRCGGRGSIITNPCVVCRGAGQAKQKKRVTVPVPAGVEDGQTVRMP------ 321

  Fly   228 PNLEPANVVFIIRDKPHPIFRRDGNNLLYTAEISLKDALCG-----------LHVMVPTLLGRPM 281
              :....:....|.:..|:|||||.::.....||:..|:.|           ::|.:|.      
  Rat   322 --VGKREIFVTFRVQKSPVFRRDGADIHSDLFISIAQAILGGTAKAQGLYETINVTIPA------ 378

  Fly   282 ELKTDVGEVISPKSVRRILGYGLPDSINNSRRGSIVVRFSIQFPDAISKELASSLDRLL 340
            .::||....::.|.:.||..||.         |...:...|:.|    |.|:|....|:
  Rat   379 GIQTDQKIRLTGKGIPRINSYGY---------GDHYIHIKIRVP----KRLSSRQQNLI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 101/373 (27%)
DnaJ 4..65 CDD:278647 34/61 (56%)
DnaJ_C 163..326 CDD:199909 38/188 (20%)
Dnaja3NP_001033684.2 DnaJ 90..480 CDD:223560 105/384 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.