DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and dnajb12a

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_997824.1 Gene:dnajb12a / 324005 ZFINID:ZDB-GENE-030131-2725 Length:371 Species:Danio rerio


Alignment Length:253 Identity:61/253 - (24%)
Similarity:100/253 - (39%) Gaps:74/253 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAKAYEVLSDKKKRGSYDSR 67
            ||||:.||:.:.|::.:::|||.|.||::|||||.:|.|.|.||.:..||.|||:.:||..||. 
Zfish   107 KDYYETLGVSKEASEEDLKKAYRKLALKFHPDKNHAPGATEAFKAIGNAYAVLSNPEKRRQYDV- 170

  Fly    68 NDKGTRRNTANQGSGFGDGTAFGSCGGGSGSGSGGGSGGGRQNNPRANFGRFFDNSESYSTFFED 132
                           :|:..|                      :|          :..:.|:..:
Zfish   171 ---------------YGEEKA----------------------HP----------THRHRTYHRN 188

  Fly   133 IENDFDSDD--DVLLGGGAGAP--------------KRRCEQQSPQSSIEHVIYVALED-----I 176
            .|.|...:|  ::..|||....              ::|.|:|..|......::|.|..     |
Zfish   189 FEADISPEDLFNMFFGGGFPTSNVHVYSNGRMRFGHQQRHERQEQQREGGLALFVQLMPILILII 253

  Fly   177 ANGCNRRMKIS---RASGRNGVDGVQYDRILTVKIPPGCKAGTKICFPNEGIQLPNLE 231
            .:..::.|..|   ..|.|..:......:..|:|:|  ...|.......:|:.|.|:|
Zfish   254 VSALSQMMVSSPPYSLSHRPSLGHTSRRQTATLKVP--YYVGDHFSEEYKGMNLKNVE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 61/253 (24%)
DnaJ 4..65 CDD:278647 29/60 (48%)
DnaJ_C 163..326 CDD:199909 15/77 (19%)
dnajb12aNP_997824.1 DnaJ 107..>211 CDD:223560 42/151 (28%)
DnaJ 108..169 CDD:278647 29/60 (48%)
DUF1977 263..363 CDD:286411 11/49 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589229
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.