DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and Dnajb5

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_038966057.1 Gene:Dnajb5 / 313811 RGDID:1307453 Length:420 Species:Rattus norvegicus


Alignment Length:367 Identity:148/367 - (40%)
Similarity:204/367 - (55%) Gaps:49/367 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAKAYEVLSDKKKRGSYD 65
            |.|||||||||...||:.||:|||.|.||:|||||||.|.|||.||::|:||:||||.|||..||
  Rat    73 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRSLYD 137

  Fly    66 SRNDKGTRRNTANQGSGFGDGTAFGSCGGGSGSGSGGGSGGGRQNNPRANFGRFFDNSESYSTF- 129
            ...::|.:                  .|||:..||||........:|.|.|..||..|..:..| 
  Rat   138 QYGEEGLK------------------TGGGTSGGSGGSFHYTFHGDPHATFASFFGGSNPFDIFF 184

  Fly   130 -----------FEDIENDFDSDDDVL-------LGGGAGAPKRRCEQQSPQSSIE-----HVIYV 171
                       |:..:.|.|.|:|..       ..|.:..|:|..|...|:..::     |.:.|
  Rat   185 ASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRV 249

  Fly   172 ALEDIANGCNRRMKISRASGRNGVDGVQY---DRILTVKIPPGCKAGTKICFPNEGIQLPNLEPA 233
            :||:|.:|..:||||:|.  |...||...   |:||.:.|..|.|.||||.||.||...|:..||
  Rat   250 SLEEIYHGSTKRMKITRR--RLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPA 312

  Fly   234 NVVFIIRDKPHPIFRRDGNNLLYTAEISLKDALCGLHVMVPTLLGRPMELKTDVGEVISPKSVRR 298
            ::||:::||||..|||||.|:||:|.||||:||||..|.:||:.||.:.|..:  :||.|.:|:|
  Rat   313 DIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCN--DVIKPGTVKR 375

  Fly   299 ILGYGLPDSINNSRRGSIVVRFSIQFPDAISKELASSLDRLL 340
            :.|.|||.....::||.::|.|.::|||.::.:....|.:.|
  Rat   376 LRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 146/356 (41%)
DnaJ 4..65 CDD:278647 41/60 (68%)
DnaJ_C 163..326 CDD:199909 74/170 (44%)
Dnajb5XP_038966057.1 DnaJ 72..415 CDD:223560 147/363 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347707
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24078
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X227
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.