DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and Dnajb12

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001013929.1 Gene:Dnajb12 / 294513 RGDID:1359677 Length:378 Species:Rattus norvegicus


Alignment Length:198 Identity:61/198 - (30%)
Similarity:81/198 - (40%) Gaps:67/198 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAKAYEVLSDKKKRGSYDSR 67
            ||||:|||:.|:|:|.:::|||.|.||::|||||.:|.|.|.||.:..||.|||:.:||..||. 
  Rat   110 KDYYEILGVSRSASDEDLKKAYRKLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQ- 173

  Fly    68 NDKGTRRNTANQGSGFGDGTAFGSCGGGSGSGSGGGSGGGRQNNPRANFGRFFDNSESYSTFFED 132
                           |||                       ..|..|..|      .|:..|...
  Rat   174 ---------------FGD-----------------------DKNQAARHG------HSHGDFHRG 194

  Fly   133 IENDFDSDD--DVLLGGGAGAPKRRCEQQSPQSSIEHVIYVALEDIANGCNRRMKISRASGR-NG 194
            .|.|...:|  ::..|||           .|.|:: ||       .:||..|.....|...| |.
  Rat   195 FEADISPEDLFNMFFGGG-----------FPSSNV-HV-------YSNGRMRYTYQQRQDRRDNQ 240

  Fly   195 VDG 197
            .||
  Rat   241 GDG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 61/198 (31%)
DnaJ 4..65 CDD:278647 32/60 (53%)
DnaJ_C 163..326 CDD:199909 11/36 (31%)
Dnajb12NP_001013929.1 DnaJ 111..172 CDD:278647 32/60 (53%)
DUF1977 269..369 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347704
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.