DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and Dnajb6

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001365764.1 Gene:Dnajb6 / 23950 MGIID:1344381 Length:372 Species:Mus musculus


Alignment Length:148 Identity:59/148 - (39%)
Similarity:74/148 - (50%) Gaps:41/148 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIQRTANDGEIRKAYHKQALRYHPDKN--KSPQAEEIFKQVAKAYEVLSDKKKRGSYDS 66
            |||::||:||.|:..:|:|||.||||::|||||  ...:||..|||||:|||||||.|||..||.
Mouse     3 DYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDK 67

  Fly    67 RNDKGTRRNTANQGSGFGDGTAFGSCGGGSGSGSGGGSGGGRQ-----------NNPRANFGRFF 120
            ...:|.                           :|||.|||..           .||...|..||
Mouse    68 YGKEGL---------------------------NGGGGGGGIHFDSPFEFGFTFRNPDDVFREFF 105

  Fly   121 DNSESYS-TFFEDIENDF 137
            ...:.:| .||||..:||
Mouse   106 GGRDPFSFDFFEDPFDDF 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 59/148 (40%)
DnaJ 4..65 CDD:278647 38/62 (61%)
DnaJ_C 163..326 CDD:199909
Dnajb6NP_001365764.1 Interaction with HSP70. /evidence=ECO:0000250 1..147 59/148 (40%)
DnaJ 2..>138 CDD:223560 59/148 (40%)
Interaction with KRT18. /evidence=ECO:0000250 120..235 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844345
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.