DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and dnj-26

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_502326.1 Gene:dnj-26 / 178171 WormBaseID:WBGene00001044 Length:365 Species:Caenorhabditis elegans


Alignment Length:132 Identity:41/132 - (31%)
Similarity:61/132 - (46%) Gaps:17/132 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAKAYEVLSDKKKRGSYDSR 67
            ||:||||.:.:.|:..|||.|:.|:....||||.|.|.|.|..|.|..|:.:|.|..||..||.:
 Worm    26 KDFYKILNVDKKASPDEIRIAFRKRIREVHPDKCKHPSATEASKVVNNAFSLLMDPAKRRQYDLQ 90

  Fly    68 NDKGTRRNTANQGSGFGDGTAFGSCGGGSGSGSGGGSGGGRQNNPRA--NFGRFFDNSESYSTFF 130
            |.:.:..|            .:..|...........|...|||:.::  :.|:   .:|..|:|.
 Worm    91 NAETSNEN------------LYKRCNRNKNQRKQEYSNTQRQNHKKSEPSNGK---RNEQNSSFK 140

  Fly   131 ED 132
            :|
 Worm   141 QD 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 41/132 (31%)
DnaJ 4..65 CDD:278647 26/60 (43%)
DnaJ_C 163..326 CDD:199909
dnj-26NP_502326.1 DnaJ 27..88 CDD:365959 26/60 (43%)
DUF4887 <81..174 CDD:374444 16/77 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.