DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and dnj-27

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001040704.1 Gene:dnj-27 / 173065 WormBaseID:WBGene00001045 Length:788 Species:Caenorhabditis elegans


Alignment Length:166 Identity:47/166 - (28%)
Similarity:72/166 - (43%) Gaps:37/166 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGIQRTANDGEIRKAYHKQALRYHPDKN-KSPQAEEIFKQVAKAYEVLSDKKKRGSYDS 66
            :|||::||::|.|:|..||||:.|.|::.|||:| ..|.|.:.|.::.||||||.|:..|..||.
 Worm    19 EDYYELLGVERDADDRTIRKAFKKLAIKKHPDRNTDDPNAHDEFVKINKAYEVLKDENLRKKYDQ 83

  Fly    67 RNDKGTRRNTANQGSGFGDGTAFGSCGGGSGSGSGGGSGGGRQNNPRA------NFGRFFDNSES 125
            ..:||..       .||..|                       ||.::      |||.:.|:.|.
 Worm    84 FGEKGLE-------DGFQGG-----------------------NNYQSWQFYNDNFGIYDDDQEI 118

  Fly   126 YSTFFEDIENDFDSDDDVLLGGGAGAPKRRCEQQSP 161
            .:....|.:......:::............|.|.:|
 Worm   119 VTLNRADFQRMVSDSNEIWFINFYSTYCSHCHQLAP 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 47/166 (28%)
DnaJ 4..65 CDD:278647 29/61 (48%)
DnaJ_C 163..326 CDD:199909
dnj-27NP_001040704.1 DnaJ 18..>150 CDD:223560 44/160 (28%)
DnaJ 20..82 CDD:278647 29/61 (48%)
PDI_a_ERdj5_N 116..214 CDD:239301 5/39 (13%)
Thioredoxin_like 222..>312 CDD:294274
ER_PDI_fam 438..750 CDD:273457
PDI_a_ERdj5_C 438..543 CDD:239302
PDI_a_ERdj5_C 549..664 CDD:239302
PDI_a_ERdj5_C 670..773 CDD:239302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.