DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and dnj-4

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_491558.1 Gene:dnj-4 / 172173 WormBaseID:WBGene00001022 Length:274 Species:Caenorhabditis elegans


Alignment Length:144 Identity:35/144 - (24%)
Similarity:61/144 - (42%) Gaps:36/144 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAKAYEVLSDKKKRGSYDSR 67
            :.:|::||::.||...||:.|::.|:.:.|||.:....|...|.::..||:||.....|..||.:
 Worm    27 RTHYEVLGVESTATLSEIKSAFYAQSKKVHPDNSSEESATASFLELKNAYDVLRRPADRRLYDYQ 91

  Fly    68 NDKGTRRNTANQGSGFGDGTAFGSCGGGSGSGSGGG---SGGGRQNNPRANFGRFFDNSESYSTF 129
                                          ...|||   :||.|...|  |....:|.|..:||:
 Worm    92 ------------------------------LRGGGGRYPNGGQRYQYP--NTAPQYDFSRDWSTY 124

  Fly   130 F-EDIENDFDSDDD 142
            : ::.:|...|.::
 Worm   125 WSQNPDNSRSSREE 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 35/144 (24%)
DnaJ 4..65 CDD:278647 19/60 (32%)
DnaJ_C 163..326 CDD:199909
dnj-4NP_491558.1 CbpA 27..>155 CDD:225124 35/144 (24%)
DnaJ 28..89 CDD:365959 19/60 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.