DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and Dnajb3

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_032325.2 Gene:Dnajb3 / 15504 MGIID:1306822 Length:242 Species:Mus musculus


Alignment Length:273 Identity:76/273 - (27%)
Similarity:97/273 - (35%) Gaps:124/273 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIQRTANDGEIRKAYHKQALRYHPDKN--KSPQAEEIFKQVAKAYEVLSDKKKRGSYDS 66
            |||::||:.|.|:...|||||.|.||::|||||  ...:||..|||||:|||||||.:||..||.
Mouse     3 DYYEVLGVPRQASAEAIRKAYRKLALKWHPDKNPEHKEEAERRFKQVAQAYEVLSDVRKREVYDR 67

  Fly    67 ------------------------------------------------------RNDKGTRRNTA 77
                                                                  .|..|.||:|.
Mouse    68 CGEVGEVGGGGAAGSPFHDAFQYVFSFRDPAEVFREFFGGHDPFSFDFFGGDPLENFFGDRRSTR 132

  Fly    78 NQGS--------------GFGDG--------TAFGSCGGGSGSGS-----GGGSGGGRQNNPRAN 115
            ...|              |||.|        |:||| .|.||..|     |||:.|         
Mouse   133 GSRSRGAVPFSTSFTEFPGFGGGFASLDTGFTSFGS-PGNSGLSSFSMSCGGGAAG--------- 187

  Fly   116 FGRFFDNSESYSTFFEDIENDFDSDDDVLLGGGAGAPKRRCEQQSPQSSIEHVIYVALED----- 175
                  |.:|.||..|            ::.|.....||..|....:..:|       ||     
Mouse   188 ------NYKSVSTSTE------------IINGKKITTKRIVENGQERVEVE-------EDGELKS 227

  Fly   176 -IANGCNRRMKIS 187
             |.||..:.::|:
Mouse   228 LIINGKEQLLRIN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 76/273 (28%)
DnaJ 4..65 CDD:278647 36/62 (58%)
DnaJ_C 163..326 CDD:199909 7/31 (23%)
Dnajb3NP_032325.2 DnaJ 3..66 CDD:278647 36/62 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844330
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.