DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and DNAJC21

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_011512267.2 Gene:DNAJC21 / 134218 HGNCID:27030 Length:676 Species:Homo sapiens


Alignment Length:101 Identity:39/101 - (38%)
Similarity:58/101 - (57%) Gaps:18/101 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGIQRTANDGEIRKAYHKQALRYHPDKN--KSPQAEEIFKQVAKAYEVLSDKKKRGSYD 65
            |.:|:.||::|.|::.|::|||.|.||::|||||  .:.:|.|.||.:..||:||||.::|..||
Human    89 KCHYEALGVRRDASEEELKKAYRKLALKWHPDKNLDNAAEAAEQFKLIQAAYDVLSDPQERAWYD 153

  Fly    66 SRND---KG-------------TRRNTANQGSGFGD 85
            :..:   ||             .|..|....||:||
Human   154 NHREALLKGGFDGEYQDDSLDLLRYFTVTCYSGYGD 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 39/101 (39%)
DnaJ 4..65 CDD:278647 28/62 (45%)
DnaJ_C 163..326 CDD:199909
DNAJC21XP_011512267.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.