powered by:
Protein Alignment CG2887 and DNAJC21
DIOPT Version :9
Sequence 1: | NP_572633.1 |
Gene: | CG2887 / 31978 |
FlyBaseID: | FBgn0030207 |
Length: | 342 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_011512267.2 |
Gene: | DNAJC21 / 134218 |
HGNCID: | 27030 |
Length: | 676 |
Species: | Homo sapiens |
Alignment Length: | 101 |
Identity: | 39/101 - (38%) |
Similarity: | 58/101 - (57%) |
Gaps: | 18/101 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KDYYKILGIQRTANDGEIRKAYHKQALRYHPDKN--KSPQAEEIFKQVAKAYEVLSDKKKRGSYD 65
|.:|:.||::|.|::.|::|||.|.||::||||| .:.:|.|.||.:..||:||||.::|..||
Human 89 KCHYEALGVRRDASEEELKKAYRKLALKWHPDKNLDNAAEAAEQFKLIQAAYDVLSDPQERAWYD 153
Fly 66 SRND---KG-------------TRRNTANQGSGFGD 85
:..: || .|..|....||:||
Human 154 NHREALLKGGFDGEYQDDSLDLLRYFTVTCYSGYGD 189
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG2887 | NP_572633.1 |
DnaJ |
1..331 |
CDD:223560 |
39/101 (39%) |
DnaJ |
4..65 |
CDD:278647 |
28/62 (45%) |
DnaJ_C |
163..326 |
CDD:199909 |
|
DNAJC21 | XP_011512267.2 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.