Sequence 1: | NP_572633.1 | Gene: | CG2887 / 31978 | FlyBaseID: | FBgn0030207 | Length: | 342 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001096348.1 | Gene: | dnajc18 / 100124938 | XenbaseID: | XB-GENE-5795683 | Length: | 483 | Species: | Xenopus tropicalis |
Alignment Length: | 210 | Identity: | 63/210 - (30%) |
---|---|---|---|
Similarity: | 82/210 - (39%) | Gaps: | 68/210 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 DYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAKAYEVLSDKKKRGSYDS-- 66
Fly 67 ----------------------------------RNDKGTRRNTANQGSGF-----GDGTAFGSC 92
Fly 93 G-------GGSGSGSGGGSGGG-------RQNNPRANFGRFFDNSES---YSTFFEDIENDFDSD 140
Fly 141 DDVLLGGGAGAPKRR 155 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2887 | NP_572633.1 | DnaJ | 1..331 | CDD:223560 | 63/210 (30%) |
DnaJ | 4..65 | CDD:278647 | 35/60 (58%) | ||
DnaJ_C | 163..326 | CDD:199909 | |||
dnajc18 | NP_001096348.1 | DnaJ | 111..172 | CDD:306689 | 35/60 (58%) |
Rho | <213..>346 | CDD:333130 | 26/108 (24%) | ||
DUF1977 | 375..473 | CDD:312722 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |