DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2887 and dnajc18

DIOPT Version :9

Sequence 1:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001096348.1 Gene:dnajc18 / 100124938 XenbaseID:XB-GENE-5795683 Length:483 Species:Xenopus tropicalis


Alignment Length:210 Identity:63/210 - (30%)
Similarity:82/210 - (39%) Gaps:68/210 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGIQRTANDGEIRKAYHKQALRYHPDKNKSPQAEEIFKQVAKAYEVLSDKKKRGSYDS-- 66
            |||.:||:.:.||:..:||||.|.|||||||||.||.|.|.||.:.||:.||||..:|.|||.  
 Frog   111 DYYSLLGVSKDANEETVRKAYLKLALRYHPDKNSSPGATETFKAIGKAFSVLSDPAQRKSYDDAQ 175

  Fly    67 ----------------------------------RNDKGTRRNTANQGSGF-----GDGTAFGSC 92
                                              :..:.|.|...::|..:     .||......
 Frog   176 AKARVVSQPDLTTEDLFDLFFKGHFPGYAFSQQYQQPRSTNRRQGDRGQRWEEEEEEDGRQQWRQ 240

  Fly    93 G-------GGSGSGSGGGSGGG-------RQNNPRANFGRFFDNSES---YSTFFEDIENDFDSD 140
            |       |.....|....|||       |:..|.:..||:..|::.   .|...|:..||    
 Frog   241 GEDTRQDRGRERKWSEERQGGGPMPKWWEREKKPESGKGRWSKNAKQDGRQSKVNEEKRND---- 301

  Fly   141 DDVLLGGGAGAPKRR 155
                  ||.|.||.|
 Frog   302 ------GGKGRPKWR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2887NP_572633.1 DnaJ 1..331 CDD:223560 63/210 (30%)
DnaJ 4..65 CDD:278647 35/60 (58%)
DnaJ_C 163..326 CDD:199909
dnajc18NP_001096348.1 DnaJ 111..172 CDD:306689 35/60 (58%)
Rho <213..>346 CDD:333130 26/108 (24%)
DUF1977 375..473 CDD:312722
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.