DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2889 and ZAP1

DIOPT Version :9

Sequence 1:NP_001245615.1 Gene:CG2889 / 31977 FlyBaseID:FBgn0030206 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_012479.1 Gene:ZAP1 / 853390 SGDID:S000003592 Length:880 Species:Saccharomyces cerevisiae


Alignment Length:449 Identity:91/449 - (20%)
Similarity:142/449 - (31%) Gaps:163/449 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 EDEKPCLQASDSEPEVTEGQPESESDSSDDEPLVRLKSKMKPKRKTSARSSKDQGPISLQQELAD 217
            :.|.|.|      |:||....::           |.....|....|...|.:|..|.|:      
Yeast   514 QSEPPSL------PKVTHQNQKN-----------RRSWPTKDLESTDFSSLEDSLPSSI------ 555

  Fly   218 LLDDGGKRRRRKAPDQRTTT--------ESQESELQAVLERKPKGCS-----RAQLAKSY----- 264
                       ..|.|.|:|        |.:.::|:...:..|:.||     :..|.|.:     
Yeast   556 -----------SPPIQTTSTINFNWCFKEEKNNDLKCKWKECPESCSSLFDLQRHLLKDHVSQDF 609

  Fly   265 ----EKAIASYMSASCDL-------------C--------EFSAP------YLSELKTHFL---- 294
                |....::  ..||.             |        :|:.|      .:|:.|.|.|    
Yeast   610 KHPMEPLACNW--EDCDFLGDDTCSIVNHINCQHGINFDIQFANPDSFLPGSISKEKHHLLHCPN 672

  Fly   295 -EVHQREYYIKCCGKVFTRASKLMDHIRKHINPKLFTCTI--CKKSLNSQDYLATHIETVHNKVA 356
             :.|:   ..|..|.....::..:.:|.....|:...|..  |.||.:|...|..|:|.||   .
Yeast   673 PQTHE---VSKADGAPDMTSANDVSNIPPIKQPEQVICQWDGCNKSFSSAQELNDHLEAVH---L 731

  Fly   357 QIGKVLKFPC--PKCERTFSSERRMANHLAKHDTDQLEHTCEICCKSFANVHRLRRHIQSIHEDL 419
            ..|| .::.|  ..|.|||...:::..||..| :....:.|:.|.:.|::...|.:|.:: |...
Yeast   732 TRGK-SEYQCLWHDCHRTFPQRQKLIRHLKVH-SKYKPYKCKTCKRCFSSEETLVQHTRT-HSGE 793

  Fly   420 HRHVCDICGKKFKFKPSFERHLLEHQGVVAPAVECPICRVWLKNEHSLRLHRFTHDSTDTVCPHC 484
            ..:.|.||.|||....|.:.|:..|.|      |.|                             
Yeast   794 KPYKCHICNKKFAISSSLKIHIRTHTG------EKP----------------------------- 823

  Fly   485 GKTCTSRTALRGHVKYAHKLTTNLQCTFCEKTFKQQRNLDEHMAIHTGLQLYNCPHCPK 543
                                   |||..|.|.|.:..||.:|:..|.  :.|.|..|.|
Yeast   824 -----------------------LQCKICGKRFNESSNLSKHIKTHQ--KKYKCSDCSK 857

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2889NP_001245615.1 zf-AD 2..79 CDD:285071
C2H2 Zn finger 276..297 CDD:275368 9/52 (17%)
C2H2 Zn finger 306..323 CDD:275368 2/16 (13%)
C2H2 Zn finger 331..352 CDD:275368 8/22 (36%)
C2H2 Zn finger 366..386 CDD:275368 7/21 (33%)
C2H2 Zn finger 395..416 CDD:275368 5/20 (25%)
C2H2 Zn finger 424..444 CDD:275368 8/19 (42%)
C2H2 Zn finger 481..502 CDD:275368 0/20 (0%)
C2H2 Zn finger 510..530 CDD:275368 7/19 (37%)
C2H2 Zn finger 538..556 CDD:275368 3/6 (50%)
ZAP1NP_012479.1 COG5048 292..761 CDD:227381 58/289 (20%)
C2H2 Zn finger 743..762 CDD:275368 6/18 (33%)
SUF4-like 766..>814 CDD:411020 13/48 (27%)
C2H2 Zn finger 770..795 CDD:411020 6/25 (24%)
C2H2 Zn finger 770..790 CDD:275368 5/20 (25%)
C2H2 Zn finger 798..818 CDD:275368 8/19 (42%)
zf-H2C2_2 810..834 CDD:404364 11/81 (14%)
C2H2 Zn finger 826..846 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.