DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2889 and CG15073

DIOPT Version :9

Sequence 1:NP_001245615.1 Gene:CG2889 / 31977 FlyBaseID:FBgn0030206 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_611362.2 Gene:CG15073 / 37155 FlyBaseID:FBgn0034379 Length:580 Species:Drosophila melanogaster


Alignment Length:598 Identity:165/598 - (27%)
Similarity:257/598 - (42%) Gaps:98/598 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MICRLCLRCLSPGSAVFLFETDDTLAETRLVKMIAKFLQLEILPDDGISTSVCTECCEHLEDFNG 65
            |||||||..::....:.:||  |......:..::||:...|...||.|||.:|..|...:.||:.
  Fly     1 MICRLCLNNVNDTDTIRIFE--DVGLSLNVANVLAKYFWFEPKSDDPISTVICLTCWNQVNDFHQ 63

  Fly    66 FWQLVEQKQCSLKKEFLTVDVDCAAMKWTGGVDVDVNIDELPLAAGDMDEKPLDLHNLSLLGSVL 130
            |:..||.....|.:.|                         .|.:|....|              
  Fly    64 FYVAVESAHRLLTERF-------------------------SLKSGQDQGK-------------- 89

  Fly   131 DVNVDSVEVREPIKEQLPCEEEEDEKPCL------------------------QASDSEPEVTEG 171
                  ||..|..::|   |||:||...|                        |.:||.|...:.
  Fly    90 ------VEHGEDSEQQ---EEEQDEDQELGLPGSEGGSFTNEQFLTEVIAQQEQQTDSNPPKEQF 145

  Fly   172 QPESESDSSDDEPLVRLKSKMKPKRKTSARSSKDQG-PISLQQELADLLDDGGKRRRRKAPDQRT 235
            ..|..:..:|.|....|.::.:.:.:::|:|..... |.|...|.::.:.:..|.:|.....:.|
  Fly   146 IKEDNATVNDPETSATLPTEQRRETRSTAKSKAHHSLPPSTPPEKSNSVANKSKAKRTPCKAEGT 210

  Fly   236 TTESQE--SELQAVLERKPKGCSRAQLAKSYEKAIASYMSASCDLCEFSAPYLSELKTHFLEVHQ 298
            ..:|:.  ...|.:|:...|              |:::|..:||:|.........|..|.|:.|.
  Fly   211 PQKSKRYADYKQCMLDIDAK--------------ISAHMRLTCDVCHEGQETFLLLCKHMLQEHH 261

  Fly   299 REYYIKCCGKVFTRASKLMDHIRKHINPKLFTCTICKKSLNSQDYLATHIETVHNKVAQIGKVLK 363
            |:.|..||.|.|.:.|.|.|||.:|.:|:.|.||.|.|....:..|..|....|:...:    ..
  Fly   262 RKGYAICCNKKFYKRSFLTDHIDRHADPEKFKCTQCDKRFADKQCLRNHELLKHHPEEE----KT 322

  Fly   364 FPCPKCERTFSSERRMANHLAKHDTDQLEHTCEICCKSFANVHRLRRHIQSIHEDLHRHVCDICG 428
            |.|.:|.:.::.:..:..|...|....:  .|::|.:.|.|...|..|::..|.: :..:||||.
  Fly   323 FMCEQCPKRYTKQYLLDQHRVIHKERNV--VCDLCERRFPNQSLLCTHVKMAHGN-YGTMCDICA 384

  Fly   429 KKFKFKPSFERHLLEHQGVVAPAVECPICRVWLKNEHSLRLHRFTHDSTDTVCPHCGKTCTSRTA 493
            :..:.:.:|:||.|||.||..|.|:|.||..|.||:|||:.|...|:.|...|..|||...:|:|
  Fly   385 QVIRGRAAFQRHQLEHAGVTEPKVQCDICGSWHKNKHSLKKHVRRHNGTAATCDLCGKVSPNRSA 449

  Fly   494 LRGHVKYAHKLTTNLQCTFCEKTFKQQRNLDEHMAIHTGLQLYNCPHCPKECRSRSNMYVHIKQR 558
            :..|.:|.|......:|:.|.|.||:...|.|||.:|||..||.||||||...|.:|.:.|.::.
  Fly   450 MLSHQRYVHLTDRKHECSVCNKAFKKAITLREHMTMHTGEVLYKCPHCPKTFNSNANQHTHRRKC 514

  Fly   559 HADEWLRAKMARS 571
            |..|:..|:.||:
  Fly   515 HPKEFEEARKART 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2889NP_001245615.1 zf-AD 2..79 CDD:285071 25/76 (33%)
C2H2 Zn finger 276..297 CDD:275368 6/20 (30%)
C2H2 Zn finger 306..323 CDD:275368 8/16 (50%)
C2H2 Zn finger 331..352 CDD:275368 6/20 (30%)
C2H2 Zn finger 366..386 CDD:275368 3/19 (16%)
C2H2 Zn finger 395..416 CDD:275368 6/20 (30%)
C2H2 Zn finger 424..444 CDD:275368 8/19 (42%)
C2H2 Zn finger 481..502 CDD:275368 8/20 (40%)
C2H2 Zn finger 510..530 CDD:275368 9/19 (47%)
C2H2 Zn finger 538..556 CDD:275368 9/17 (53%)
CG15073NP_611362.2 zf-AD 2..78 CDD:285071 25/77 (32%)
C2H2 Zn finger 269..286 CDD:275368 8/16 (50%)
C2H2 Zn finger 294..316 CDD:275368 6/21 (29%)
C2H2 Zn finger 325..345 CDD:275368 3/19 (16%)
C2H2 Zn finger 352..370 CDD:275368 6/17 (35%)
C2H2 Zn finger 410..430 CDD:275368 10/19 (53%)
C2H2 Zn finger 437..458 CDD:275368 8/20 (40%)
C2H2 Zn finger 466..486 CDD:275368 9/19 (47%)
C2H2 Zn finger 494..512 CDD:275368 9/17 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134721
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25790
OrthoDB 1 1.010 - - D28261at33392
OrthoFinder 1 1.000 - - FOG0000909
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.