DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2889 and ZNF677

DIOPT Version :9

Sequence 1:NP_001245615.1 Gene:CG2889 / 31977 FlyBaseID:FBgn0030206 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001304927.1 Gene:ZNF677 / 342926 HGNCID:28730 Length:584 Species:Homo sapiens


Alignment Length:545 Identity:130/545 - (23%)
Similarity:226/545 - (41%) Gaps:76/545 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 WQLVEQKQCSLKKE--------FLTVDVDCAAMKWTGGVDVDVNIDELPLAAGDMDEKPLDLHNL 123
            |:.::..|.:|.::        .|::|.|....:    .|:.|......|:..:.:::  :|::|
Human    22 WECLDPAQRALYRDVMLENYRNLLSLDEDNIPPE----DDISVGFTSKGLSPKENNKE--ELYHL 80

  Fly   124 SLLGSVLDVNVDSVEVREPIKEQLP-------------------CEEEEDEKPCLQASDSEPEVT 169
            .:|.......:::.:::| :.|.:|                   |.:....:...|.:.|....:
Human    81 VILERKESHGINNFDLKE-VWENMPKFDSLWDYDVKNYKGMPLTCNKNLTHRKDQQHNKSSIHFS 144

  Fly   170 EGQPESESDSS-----DDEPLVR----LKSKMKPKRKTSARSSKDQGPISLQQELADLLD-DGGK 224
            ..|..|..||:     .|:|.:|    ||:.::.......:..:::..:|||.:||:|.. ..|:
Human   145 LKQSVSIRDSAHQYFIHDKPFIRNLLKLKNNIRYAGNKYVKCFENKIGLSLQAQLAELQRFQTGE 209

  Fly   225 RRRRKAPDQRTTTESQESELQAVLERKPKGCSRAQLAKSYEKAIASY-------MSASCDLCEFS 282
            :.....|.:::...|..|.|...::..   |::.:....|......|       .|..|:.|..:
Human   210 KMYECNPVEKSINSSSVSPLPPCVKNI---CNKYRKILKYPLLHTQYGRTHIREKSYKCNDCGKA 271

  Fly   283 APYLSELKTHFLEVH--QREYYIKCCGKVFTRASKLMDHIRKHINPKLFTCTICKKSLNSQDYLA 345
            ....|.|..| ..:|  ||.|....|||.|.:.|.|..|.|.|...|.:.|.||.|..:....||
Human   272 FSKSSNLTNH-QRIHSGQRPYKCNECGKAFNQCSNLTRHQRVHTGEKPYQCNICGKVCSQNSNLA 335

  Fly   346 THIETVHNKVAQIGKVLKFPCPKCERTFSSERRMANHLAKHDTDQLEHTCEICCKSFANVHRLRR 410
            :| :.:|.     |: ..:.|.:|.:.|.....:..|...| |.:..:.|..|.|:||....|.:
Human   336 SH-QRMHT-----GE-KPYKCNECGKAFIQRSHLWGHERIH-TGEKPYKCNECDKAFAERSSLTQ 392

  Fly   411 HIQSIHEDLHRHVCDICGKKFKFKPSFERHLLEHQGVVAPAVECPIC-RVWLKNEHSLRLHRFTH 474
            | :.||.....::|:.|||.||......||...|.|  ....:|.:| |.::::. ||..|:..|
Human   393 H-KRIHTGEKPYICNECGKAFKQCSHLTRHQNIHPG--EKPHKCNVCGRAFIQSS-SLVEHQRIH 453

  Fly   475 DSTDTV-CPHCGKTCTSRTALRGHVKYAHKLTTNLQCTFCEKTFKQQRNLDEHMAIHTGLQLYNC 538
            ...... |..|.|....|:.|.||.: .|......:||.|.|.|.::.||.:|..||||.:.|.|
Human   454 TGEKPYKCNKCDKAFIKRSHLWGHQR-THTGEKPYKCTECGKAFTERSNLTQHKKIHTGEKPYKC 517

  Fly   539 PHCPKECRSRSNM----YVHIKQRH 559
            ..|.|.....:|:    .:||:::|
Human   518 TECGKAFTQFANLTRHQKIHIEKKH 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2889NP_001245615.1 zf-AD 2..79 CDD:285071 3/11 (27%)
C2H2 Zn finger 276..297 CDD:275368 5/20 (25%)
C2H2 Zn finger 306..323 CDD:275368 8/16 (50%)
C2H2 Zn finger 331..352 CDD:275368 7/20 (35%)
C2H2 Zn finger 366..386 CDD:275368 4/19 (21%)
C2H2 Zn finger 395..416 CDD:275368 7/20 (35%)
C2H2 Zn finger 424..444 CDD:275368 8/19 (42%)
C2H2 Zn finger 481..502 CDD:275368 7/20 (35%)
C2H2 Zn finger 510..530 CDD:275368 8/19 (42%)
C2H2 Zn finger 538..556 CDD:275368 5/21 (24%)
ZNF677NP_001304927.1 KRAB 9..59 CDD:214630 7/40 (18%)
COG5048 194..540 CDD:227381 102/362 (28%)
C2H2 Zn finger 265..285 CDD:275368 5/20 (25%)
C2H2 Zn finger 293..313 CDD:275368 8/19 (42%)
C2H2 Zn finger 321..341 CDD:275368 7/20 (35%)
C2H2 Zn finger 349..369 CDD:275368 4/19 (21%)
C2H2 Zn finger 377..397 CDD:275368 7/20 (35%)
C2H2 Zn finger 405..425 CDD:275368 8/19 (42%)
C2H2 Zn finger 433..453 CDD:275368 6/20 (30%)
C2H2 Zn finger 461..481 CDD:275368 7/20 (35%)
C2H2 Zn finger 489..509 CDD:275368 8/19 (42%)
C2H2 Zn finger 517..537 CDD:275368 4/19 (21%)
C2H2 Zn finger 545..563 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.