DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2889 and CG11696

DIOPT Version :9

Sequence 1:NP_001245615.1 Gene:CG2889 / 31977 FlyBaseID:FBgn0030206 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster


Alignment Length:665 Identity:179/665 - (26%)
Similarity:285/665 - (42%) Gaps:133/665 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MICRLCLRCLSPGSAVFLFETD-DTLAETRLVKMIAKFLQLEILPDDGISTSVCTECCEHLEDFN 64
            |||||||.....|..:|..|.. ...|..:|.::|.:.|.|.:..:|.:||.:|..|...|.:..
  Fly     1 MICRLCLEDAEHGVPIFGQEPPMGQPAHRQLAELIERHLLLVLAENDVVSTCLCNRCWRQLAEIE 65

  Fly    65 GFWQLVEQKQCSLKKEFLTVDVDCAAMKWTGGVDVDVNIDELP--------LAAGDMDEKPLDLH 121
            .|..:|.:||.||.:                .:.:...:.|||        |...: .|.|:: .
  Fly    66 QFCSMVAEKQRSLHR----------------SLQLKTELPELPELTEPEPALVVWN-TESPIE-P 112

  Fly   122 NLSLLGSVLDVNVDSVEVREPIKEQLPCEEEEDE------KPCLQASDSEPEVTEGQPESESDSS 180
            .||..|..:..::    :.||:.:.|...:|:|.      :|     |.||   |.||:.|.:..
  Fly   113 KLSYEGDDIKDHI----LCEPVIDALSAGDEKDSDYGDTFEP-----DFEP---ESQPDEEEEPE 165

  Fly   181 DDEPLVRLKSKMKP------------KRKTSARSSKDQGPI---------SLQQELADLLDDGGK 224
            .|.  |:.:.:.:|            |||...|..:::..|         :.|:||        |
  Fly   166 PDP--VKPRPRGRPRKTALQQTHQIIKRKYEKRKQQNKAKITELSLRESRARQREL--------K 220

  Fly   225 RRRRKAPDQRTTTESQESE--------LQAVLERKPKG------------------CSRAQLAKS 263
            |....|.|.:...|.:|.|        ..|..:.||:|                  .|...:.:|
  Fly   221 RSSAGAEDDQDGDEDEEDEEDVGGELTPDADEQPKPRGKRGRPKTKKLVTADDNDDTSEVPVKRS 285

  Fly   264 YEKAIASYMSAS----CDLCEFSAPYLSELKTHFLEVHQREYYIKCCGKVFTRASKLMDHIRKHI 324
            ..|.:..|::|:    |.:|.......::||.||...|....|:|||...:.:.:..:||:..|.
  Fly   286 SIKEMDDYIAANVKLDCAICAAPLEDFNDLKRHFRVEHDCTGYVKCCNNRYKKRTLYVDHLHCHK 350

  Fly   325 NPKLFTCTICKKSLNSQDYLATHIETVHNKVAQIGKVLKFPCPKCERTFSSERRMANHLAKHDTD 389
            :|:.|:|..|:|:..:::....|:...|::..:    |...|..||..|:.:..:..||..|...
  Fly   351 DPQYFSCQSCRKNFLNRNSQVMHMLRFHSQQQE----LVHQCAICEARFAKKFLLTMHLKGHKGT 411

  Fly   390 QLEHTCEICCKSFANVHRLRRHIQSIH-EDLHRHVCDICGKKFKFKPSFERH--LLEHQGVVAPA 451
            :....|:.|.|:|.....|..|::.:| .|....:|||||..|:.|.:|..|  .|...|.|| .
  Fly   412 ERPEVCDTCSKTFRTKFELSAHVKRMHAADFTPIICDICGTHFRSKANFLIHKKALHPDGPVA-E 475

  Fly   452 VECPICRVWLKNEHSLRLHRFTHDSTD----TVCPHCGKTCTSRTALRGHVKYAHKLTTNLQCTF 512
            |:|.:|..||::|.|||.|...||..|    ..|..|....:||.||..|::|.|....: :|:.
  Fly   476 VQCTLCGRWLRDERSLRKHLARHDDRDGDTKYRCLLCNAEKSSRAALSSHMRYHHSAKRH-KCSL 539

  Fly   513 CEKTFKQQRNLDEHMAIHTGLQLYNCPHCPKECRSRSNMYVHIKQRHADEWLR------------ 565
            |:|.||..|.|.||||.|||:.||.|..|.:..:|.:||:.|.|:.|.::|:|            
  Fly   540 CDKEFKLPRALAEHMATHTGIDLYQCQFCTRTFKSHANMHNHKKKMHPNDWVRKYSQPSSSITST 604

  Fly   566 -AKMARSHNPQFKPA 579
             |.:|..::|. :||
  Fly   605 AAPLAHPNHPN-QPA 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2889NP_001245615.1 zf-AD 2..79 CDD:285071 26/77 (34%)
C2H2 Zn finger 276..297 CDD:275368 6/20 (30%)
C2H2 Zn finger 306..323 CDD:275368 3/16 (19%)
C2H2 Zn finger 331..352 CDD:275368 4/20 (20%)
C2H2 Zn finger 366..386 CDD:275368 6/19 (32%)
C2H2 Zn finger 395..416 CDD:275368 6/20 (30%)
C2H2 Zn finger 424..444 CDD:275368 10/21 (48%)
C2H2 Zn finger 481..502 CDD:275368 8/20 (40%)
C2H2 Zn finger 510..530 CDD:275368 11/19 (58%)
C2H2 Zn finger 538..556 CDD:275368 6/17 (35%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071 24/75 (32%)
C2H2 Zn finger 332..349 CDD:275368 3/16 (19%)
C2H2 Zn finger 357..378 CDD:275368 4/20 (20%)
C2H2 Zn finger 388..408 CDD:275368 6/19 (32%)
C2H2 Zn finger 417..438 CDD:275368 6/20 (30%)
C2H2 Zn finger 447..465 CDD:275368 9/17 (53%)
C2H2 Zn finger 478..498 CDD:275368 9/19 (47%)
C2H2 Zn finger 509..529 CDD:275368 7/19 (37%)
C2H2 Zn finger 537..557 CDD:275368 11/19 (58%)
C2H2 Zn finger 565..583 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134721
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000909
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.