DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2889 and zfp-2

DIOPT Version :9

Sequence 1:NP_001245615.1 Gene:CG2889 / 31977 FlyBaseID:FBgn0030206 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_496055.1 Gene:zfp-2 / 174505 WormBaseID:WBGene00009448 Length:422 Species:Caenorhabditis elegans


Alignment Length:187 Identity:54/187 - (28%)
Similarity:78/187 - (41%) Gaps:21/187 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 HTCEICCKSFANVHRLRRHIQSIHEDLHRHVCDICGKKFKFKPSFERHLLEHQGVVAPAVECPIC 457
            :.|..|...|.|....:||||.:|.|.....|..||.:|..|.|...||.:| .::.|...|..|
 Worm   171 YRCTNCKTYFGNKEVYQRHIQEVHGDARPFRCFNCGMRFANKTSMTHHLKDH-SLLKPMFSCDYC 234

  Fly   458 -RVWLKNEHSLRLHRFTHDSTDTVCPHCGKTCTSRTALRGHVKYAHKLT---------------- 505
             |::.|.|...|.|:.  ..|.:.|..|.:..|:..|||.|...||..|                
 Worm   235 PRIFSKLESKTRHHKM--HFTRSTCQTCMRFFTTEDALRHHQSTAHPATFDSGPPPEDLLPNGKS 297

  Fly   506 TNLQCTFCEKTFKQQRNLDEHMAIHTGLQLYNCPHCPKECRSRSNMYVHIKQRHADE 562
            ....|::|...|..::::..|..||||.:.|:|.:|.|.......:..||: .|..|
 Worm   298 ARYSCSYCNLRFHFKKDMLVHERIHTGEKPYSCGYCMKSFAQSQALTAHIR-THTKE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2889NP_001245615.1 zf-AD 2..79 CDD:285071
C2H2 Zn finger 276..297 CDD:275368
C2H2 Zn finger 306..323 CDD:275368
C2H2 Zn finger 331..352 CDD:275368
C2H2 Zn finger 366..386 CDD:275368
C2H2 Zn finger 395..416 CDD:275368 8/20 (40%)
C2H2 Zn finger 424..444 CDD:275368 8/19 (42%)
C2H2 Zn finger 481..502 CDD:275368 7/20 (35%)
C2H2 Zn finger 510..530 CDD:275368 4/19 (21%)
C2H2 Zn finger 538..556 CDD:275368 4/17 (24%)
zfp-2NP_496055.1 C2H2 Zn finger 173..194 CDD:275368 8/20 (40%)
C2H2 Zn finger 202..222 CDD:275368 8/19 (42%)
C2H2 Zn finger 231..251 CDD:275368 7/21 (33%)
COG5048 <251..>358 CDD:227381 27/104 (26%)
C2H2 Zn finger 257..278 CDD:275368 7/20 (35%)
C2H2 Zn finger 302..322 CDD:275368 4/19 (21%)
C2H2 Zn finger 330..350 CDD:275368 5/20 (25%)
C2H2 Zn finger 358..374 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.