DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or9a and Or98b

DIOPT Version :9

Sequence 1:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster


Alignment Length:381 Identity:124/381 - (32%)
Similarity:201/381 - (52%) Gaps:8/381 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DQSLRVQILVYRCMGIDLWSPTMANDR-PWLTFVTMGPLFLFMVPMFLA-AHEYITQVSLLSDTL 76
            |:.||:|..::|.:|::|........| ||.:...:..:..|| |:.:| ..:.:..|..|:|:|
  Fly     4 DKFLRLQSALFRLLGLELLHEQDVGHRYPWRSICCILSVASFM-PLTIAFGLQNVQNVEQLTDSL 67

  Fly    77 GSTFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDAREIIEVENQSDQMLSLTYTRC 141
            .|....:|.|.|..||.:..|:|..||.....:|..|... ..|..|:..|::.||.:|..|..|
  Fly    68 CSVLVDLLALCKIGLFLWLYKDFKFLIGQFYCVLQTETHT-AVAEMIVTRESRRDQFISAMYAYC 131

  Fly   142 FGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPYDLQVVMFYVPTYLWNVMASYSAVTMAL 206
            |..||:.|.|...:.:::|..|..|:..:.|...|||:|...:..|:.:|.|||.|:.......:
  Fly   132 FITAGLSACLMSPLSMLISYQRTGELQPKFPFPSVYPWDNMKLSNYIISYFWNVCAALGVALPTV 196

  Fly   207 CVDSLLFFFTYNVCAIFKIAKHRMIHLPAVGGKEELEGLVQVLLLHQKGLQIADHIADKYRPLIF 271
            |||:|....::|:||:|:||:|:|:|......||..|.|..|..|:...|.:...:.:.:|||| 
  Fly   197 CVDTLFCSLSHNLCALFQIARHKMMHFEGRNTKETHENLKHVFQLYALCLNLGHFLNEYFRPLI- 260

  Fly   272 LQFFLSALQICFIGFQVADLFPNPQSLYFIAFVGSLLIALFIYSKCGENIKSASLDFGNGLYETN 336
            .||..::|.:|.:.:|::.....|..|::.||..:::..:.||..||.:|.|....||..:||::
  Fly   261 CQFVAASLHLCVLCYQLSANILQPALLFYAAFTAAVVGQVSIYCFCGSSIHSECQLFGQAIYESS 325

  Fly   337 WTDFSPPTKR---ALLIAAMRAQRPCQMKGYFFEASMATFSTIVRSAVSYIMMLRS 389
            |........:   :|.||.||:...|.:.||||||:..|..||||:|:||:.:|||
  Fly   326 WPHLLQENLQLVSSLKIAMMRSSLGCPIDGYFFEANRETLITIVRTAISYVTLLRS 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 104/315 (33%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 104/314 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H62715
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009998
OrthoInspector 1 1.000 - - mtm9636
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.