DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or9a and Or98a

DIOPT Version :9

Sequence 1:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:361 Identity:67/361 - (18%)
Similarity:128/361 - (35%) Gaps:79/361 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 HEYITQVSLLSDTLGSTFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDAREIIEVE 127
            :|.:|.:.|..:::|..|       |.|.|    ..::...|..:.:|::..:.....:|.:||.
  Fly    76 NELLTVMQLFFNSVGMPF-------KVLFF----NLYISGFYKAKKLLSEMDKRCTTLKERVEVH 129

  Fly   128 ------NQSDQMLSLTYTRCFGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPYDLQVVMF 186
                  |::..:....||.        ..:..|:...||              |..|:.:     
  Fly   130 QGVVRCNKAYLIYQFIYTA--------YTISTFLSAALS--------------GKLPWRI----- 167

  Fly   187 YVP--------TYLWNVMASYS-----AVTMALCVDSLLFFFTYNVCAIFKIAKHRMIHLPAVGG 238
            |.|        :..|....:.:     |||..|..|.....:...:....|:.:.|:..|....|
  Fly   168 YNPFVDFRESRSSFWKAALNETALMLFAVTQTLMSDIYPLLYGLILRVHLKLLRLRVESLCTDSG 232

  Fly   239 KEELEG---LVQVLLLHQKGLQIADHIADKYRPLIFLQFFLSALQICFIGFQVADLFPNPQSLYF 300
            |.:.|.   |::.:..|...:..|..|.......||:||.|  :.|| :|..:.:|      |:|
  Fly   233 KSDAENEQDLIKCIKDHNLIIDYAAAIRPAVTRTIFVQFLL--IGIC-LGLSMINL------LFF 288

  Fly   301 ---------IAFVGSLLIALFIYSKCGENIKSASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQ 356
                     :|::..|::..|.:....:.:|.......:.::.:||.:.|...|.:|......||
  Fly   289 ADIWTGLATVAYINGLMVQTFPFCFVCDLLKKDCELLVSAIFHSNWINSSRSYKSSLRYFLKNAQ 353

  Fly   357 RPCQM-KGYFFEASMATFSTIVRSAVSYIMMLRSFN 391
            :.... .|..|..|..:...:.:.|.|.:..:...|
  Fly   354 KSIAFTAGSIFPISTGSNIKVAKLAFSVVTFVNQLN 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 62/344 (18%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 64/349 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.