DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or9a and Or94a

DIOPT Version :9

Sequence 1:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:426 Identity:87/426 - (20%)
Similarity:172/426 - (40%) Gaps:93/426 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KQEEKDQSLRVQILVYRCMGIDLWSPTMANDRPW-----------------LTFVTMGPLFLFMV 56
            |.:::.:|:|:.:.|.:..|  ||..::.::..|                 :||..:|   |..:
  Fly     3 KHKDRIESMRLILQVMQLFG--LWPWSLKSEEEWTFTGFVKRNYRFLLHLPITFTFIG---LMWL 62

  Fly    57 PMFLAAH-EYITQVSLLSDTLGSTFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDA 120
            ..|:::: |...||..:|.|      .|..:||.|...::|.|...|:|        |::..|| 
  Fly    63 EAFISSNLEQAGQVLYMSIT------EMALVVKILSIWHYRTEAWRLMY--------ELQHAPD- 112

  Fly   121 REIIEVENQSDQ--------------------MLSLTYTRCFGLAGIFAALKPFVGIILSSIRGD 165
               .::.||.:.                    .|.:.|:.|.|:  :|             :.| 
  Fly   113 ---YQLHNQEEVDFWRREQRFFKWFFYIYILISLGVVYSGCTGV--LF-------------LEG- 158

  Fly   166 EIHLELPHNGVYPYDLQVVMFYVPTYLWNVMASYSAVTMALCVDSLLFFFTYNVCAIFKIAKHRM 230
               .|||.....|::.|....|...|.:::..........:.:|:|..:|.:::..::::...|:
  Fly   159 ---YELPFAYYVPFEWQNERRYWFAYGYDMAGMTLTCISNITLDTLGCYFLFHISLLYRLLGLRL 220

  Fly   231 -----IHLPAVGGKEELEGLVQVLLLHQKGLQIADHIADKYRPLIFLQFFLSALQICFIGF--QV 288
                 :....:.|::    |..:.::||:...:.........|.|..|..||||.|||.|:  |.
  Fly   221 RETKNMKNDTIFGQQ----LRAIFIMHQRIRSLTLTCQRIVSPYILSQIILSALIICFSGYRLQH 281

  Fly   289 ADLFPNP-QSLYFIAFVGSLLIALFIYSKCGENIKSASLDFGNGLYETNWTDFSPPTKRALLIAA 352
            ..:..|| |.:..:.||..:::.:::....|..|...:....|.:|.|||.:..||.::.|....
  Fly   282 VGIRDNPGQFISMLQFVSVMILQIYLPCYYGNEITVYANQLTNEVYHTNWLECRPPIRKLLNAYM 346

  Fly   353 MRAQRPCQMK-GYFFEASMATFSTIVRSAVSYIMML 387
            ...::|..:: |.||...:..|...:.:|.|::.:|
  Fly   347 EHLKKPVTIRAGNFFAVGLPIFVKTINNAYSFLALL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 70/341 (21%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 71/347 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465735
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.