DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or9a and Or92a

DIOPT Version :9

Sequence 1:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524414.2 Gene:Or92a / 42425 FlyBaseID:FBgn0038798 Length:408 Species:Drosophila melanogaster


Alignment Length:431 Identity:107/431 - (24%)
Similarity:179/431 - (41%) Gaps:76/431 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KVKGKKQEEK---DQSLRVQILVYRCMGIDLWSPTMAN-DRPWLTFVTMGPLFLFMVPMFLAAHE 64
            |.|.|..:|.   |:..|..:..|:.:|.||:|....| .|.:|       |..::|..||..:.
  Fly     5 KRKPKSDDEVITFDELTRFPMTFYKTIGEDLYSDRDPNVIRRYL-------LRFYLVLGFLNFNA 62

  Fly    65 YITQ------VSLLSDT--LGST-------FASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEI 114
            |:..      |.::|.|  |.:|       |:.|....:|.| ..:||..|.|:..::.|...::
  Fly    63 YVVGEIAYFIVHIMSTTTLLEATAVAPCIGFSFMADFKQFGL-TVNRKRLVRLLDDLKEIFPLDL 126

  Fly   115 EVWPDAREIIEVENQSDQM---------LSLTYTRCFGLAGIFAALKPFVGIILSSIRGDEI--- 167
            |    |:....|......|         |.:|||..|   ..:.|:|..:...|   .|.||   
  Fly   127 E----AQRKYNVSFYRKHMNRVMTLFTILCMTYTSSF---SFYPAIKSTIKYYL---MGSEIFER 181

  Fly   168 ----HLELPHNGVYPYDLQV-VMFYVPTYLWNVMASYSAVTMALCVDSLLFFFTYNVCAIFKIAK 227
                |:      ::|||.:. :..|..:|......:|.|....:|||.||      :..|.::..
  Fly   182 NYGFHI------LFPYDAETDLTVYWFSYWGLAHCAYVAGVSYVCVDLLL------IATITQLTM 234

  Fly   228 HRMI---HLPAVGG-----KEELEGLVQVLLLHQKGLQIADHIADKYRPLIFLQFFLSALQICFI 284
            |...   .|.|..|     :|.::.|..:::.|.:.|.:::.:.:.:..||...|..::|.|||.
  Fly   235 HFNFIANDLEAYEGGDHTDEENIKYLHNLVVYHARALDLSEEVNNIFSFLILWNFIAASLVICFA 299

  Fly   285 GFQVADLFPNPQSLYFIAFVGSLLIALFIYSKCGENIKSASLDFGNGLYETNWTDFSPPTKRALL 349
            |||:.........||||.|..| |:.:|:....|:.:.|:|...|:..:..||...|...||.|.
  Fly   300 GFQITASNVEDIVLYFIFFSAS-LVQVFVVCYYGDEMISSSSRIGHSAFNQNWLPCSTKYKRILQ 363

  Fly   350 IAAMRAQRPCQMKGYFF-EASMATFSTIVRSAVSYIMMLRS 389
            ....|:|:|..::...| ..|..||..::..:..:..:||:
  Fly   364 FIIARSQKPASIRPPTFPPISFNTFMKVISMSYQFFALLRT 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 86/353 (24%)
Or92aNP_524414.2 7tm_6 80..396 CDD:251636 83/339 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465680
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.