DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or9a and Or85e

DIOPT Version :9

Sequence 1:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster


Alignment Length:464 Identity:74/464 - (15%)
Similarity:155/464 - (33%) Gaps:134/464 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MGIDLWSPTMANDR--PW---------------------LTFVTMGPLF----LFMVPMFLAAHE 64
            ||:.|.:.|..:.|  .|                     .|.:.:|.||    |.::|       
  Fly    33 MGLQLANGTKPSPRLPKWWPKRLEMIGKVLPKAYCSMVIFTSLHLGVLFTKTTLDVLP------- 90

  Fly    65 YITQVSLLSDTLGSTFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDARE------- 122
             ..::..::|.|..|.....|....:.:|...:..:..:.|:.             ||       
  Fly    91 -TGELQAITDALTMTIIYFFTGYGTIYWCLRSRRLLAYMEHMN-------------REYRHHSLA 141

  Fly   123 -IIEVENQSDQMLSLTYTRCFGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPYDLQVVMF 186
             :..|.:.:...:|..:|..:.::.:...:...|..::..||      .||....||:|......
  Fly   142 GVTFVSSHAAFRMSRNFTVVWIMSCLLGVISWGVSPLMLGIR------MLPLQCWYPFDALGPGT 200

  Fly   187 YVPTYLWNVMASYSA-----------VTMALCVDSLLFFFTYNVCAIFKIAKH-RMIHLPAVGG- 238
            |...|...:......           ||::|.   ||..|....|::..:..| :::...:|.| 
  Fly   201 YTAVYATQLFGQIMVGMTFGFGGSLFVTLSLL---LLGQFDVLYCSLKNLDAHTKLLGGESVNGL 262

  Fly   239 ---KEEL---------------------------------------EGLVQVLLLHQKGLQIADH 261
               :|||                                       ..||:.:.||:..|..:..
  Fly   263 SSLQEELLLGDSKRELNQYVLLQEHPTDLLRLSAGRKCPDQGNAFHNALVECIRLHRFILHCSQE 327

  Fly   262 IADKYRPLIFLQFFLSALQICFIGF-------QVADLFPNPQSLYFIAFVGSLLIALFIYSKCGE 319
            :.:.:.|...::......|:|.:.|       :|..:....|      ::|..:..|.:::.|||
  Fly   328 LENLFSPYCLVKSLQITFQLCLLVFVGVSGTREVLRIVNQLQ------YLGLTIFELLMFTYCGE 386

  Fly   320 NIKSASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQRPCQM-KGYFFEASMATFSTIVRSAVSY 383
            .:...|:..|:..:...|...:...::.:||..:.::|...: .|.|:...:....:::..|.|:
  Fly   387 LLSRHSIRSGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKFYVMDVNRLRSVITQAFSF 451

  Fly   384 IMMLRSFNA 392
            :.:|:...|
  Fly   452 LTLLQKLAA 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 58/383 (15%)
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 53/356 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.