DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or9a and Or85b

DIOPT Version :9

Sequence 1:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster


Alignment Length:369 Identity:82/369 - (22%)
Similarity:158/369 - (42%) Gaps:58/369 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LFMVPMFLAAHEYITQVSLLSDTLGSTFASMLTLVKFLLFCYHRKEFVGL--IYHIR----AI-- 109
            |..|.:|.:.:.|       |..:.:.|...:|.:.::.|.     .||:  ::.||    ||  
  Fly    44 LSFVGLFESIYVY-------SAFMDNKFLEAVTALSYIGFV-----TVGMSKMFFIRWKKTAITE 96

  Fly   110 LAKEI-EVWPDAREIIEVENQSDQM-------LSLTYTRCFGLA----GIFAALKPFVGIILSSI 162
            |..|: |::|:.  :|..|..:..|       :||.|:..:.:.    .:|..::.:|.....:|
  Fly    97 LINELKEIYPNG--LIREERYNLPMYLGTCSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNI 159

  Fly   163 RGDEIHLELPHNGVYPYDLQVVMFYVPTYLWNVMASYSAVTMALCVDSLLFFFTYNVCAIFKIAK 227
            |  .:..:||:....|:..|....|.|.......|.|::....:..|.||       ||   :|.
  Fly   160 R--VVGKQLPYLMYIPWKWQDNWSYYPLLFSQNFAGYTSAAGQISTDVLL-------CA---VAT 212

  Fly   228 HRMIHLPAVGG---KEELEG--------LVQVLLLHQKGLQIADHIADKYRPLIFLQFFLSALQI 281
            ..::|...:..   :.||.|        ||.::..|::.|:::|.:.|.:...:.|.|.:|:..|
  Fly   213 QLVMHFDFLSNSMERHELSGDWKKDSRFLVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVI 277

  Fly   282 CFIGFQVADLFPNPQSLYFIAFVGSLLIALFIYSKCGENIKSASLDFGNGLYETNWTDFSPPTKR 346
            ||:|||:....|....:....|:.|.:..:::....|:.:..||..|....|...|.......||
  Fly   278 CFVGFQMTVGVPPDIVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRYKR 342

  Fly   347 ALLIAAMRAQRPCQMKG-YFFEASMATFSTIVRSAVSYIMMLRS 389
            ||:|...|:|:...:|. .|.:.:.:|.:.:::.:..:..:||:
  Fly   343 ALVIIIARSQKVTFLKATIFLDITRSTMTDLLQISYKFFALLRT 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 76/344 (22%)
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 75/332 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465682
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.