DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or9a and Or83a

DIOPT Version :9

Sequence 1:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:314 Identity:64/314 - (20%)
Similarity:105/314 - (33%) Gaps:72/314 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 TYTRCFGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPYDLQVVMFYVPTYLWNVM----- 196
            ||..|..:..||....|......|          ||....||:|......|...:|...|     
  Fly   152 TYVYCCYIGTIFWLALPIAYRDRS----------LPLACWYPFDYTQPGVYEVVFLLQAMGQIQV 206

  Fly   197 ----ASYSAVTMALCV-----DSLLFFFTYNVCA-IFKIAKHRMIHLP----------------A 235
                ||.|.:.|.|||     ..:||....||.| .:.:....|..|.                |
  Fly   207 AASFASSSGLHMVLCVLISGQYDVLFCSLKNVLASSYVLMGANMTELNQLQAEQSAADVEPGQYA 271

  Fly   236 VGGKEE--LEGLVQV----------------LLLHQKGLQIA-DHIADKYRPLIFLQFFLSALQI 281
            ...:||  |:.|::|                .:.|.:.:..| ..|...|.|:.|::.......:
  Fly   272 YSVEEETPLQELLKVGSSMDFSSAFRLSFVRCIQHHRYIVAALKKIESFYSPIWFVKIGEVTFLM 336

  Fly   282 CFIGF-----QVADLFPNPQSL--YFIAFVGSLLIALFIYSKCGENIKSASLDFGNGLYETNWTD 339
            |.:.|     ..|:.|....||  |.:.    :|..|||.....:.:...|...|..|:.:.|..
  Fly   337 CLVAFVSTKSTAANSFMRMVSLGQYLLL----VLYELFIICYFADIVFQNSQRCGEALWRSPWQR 397

  Fly   340 FSPPTKRALLIAAMRAQRPCQM-KGYFFEASMATFSTIVRSAVSYIMMLRSFNA 392
            .....:...:...:.::|..|: .|.....::..|...:.:|.|::.:|:..:|
  Fly   398 HLKDVRSDYMFFMLNSRRQFQLTAGKISNLNVDRFRGTITTAFSFLTLLQKMDA 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 60/301 (20%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 58/298 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.