DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or9a and Or74a

DIOPT Version :9

Sequence 1:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster


Alignment Length:415 Identity:84/415 - (20%)
Similarity:148/415 - (35%) Gaps:80/415 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ILVYRCMGIDLWSPTMANDRPWLTFVTMGPLFLFMVPMFLAAHEYITQVSLLS-----DTLGSTF 80
            :.:||.:....| |..|....|..|  :..|.:|:..:....|..:....|::     |.:.:..
  Fly    22 VSLYRVLNHVAW-PLEAESGRWTVF--LDRLMIFLGFLVFCEHNEVDFHYLIANRQDMDNMLTGL 83

  Fly    81 ASMLTLVKFLLFCY----HRKEFVGLIYHIRAILAKEIEVWPDAREIIEVENQSDQMLSLTYTRC 141
            .:.|.||:..:.|:    |:..|..|:....|.:....|:.|.....|:.:..:.::.|..|  .
  Fly    84 PTYLILVEMQIRCFQLAWHKDRFRALLQRFYAEIYVSEEMEPHLFASIQRQMLATRVNSTVY--L 146

  Fly   142 FGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPYDLQVVMFYVPTYLWNVMASYSAVTMAL 206
            ..|...|  |.|...:|..       ..|:.:..|||:|...:.|::|..:.|....:       
  Fly   147 LALLNFF--LVPVTNVIYH-------RREMLYKQVYPFDNTQLHFFIPLLVLNFWVGF------- 195

  Fly   207 CVDSLLFFFTYNVCAIFKIAKHRMIHLPA----VGGKEELEGLVQVLLLHQKGLQIA-------D 260
            .:.|:||       ....:....|:||.|    :|  ::|....|:||.....|.:|       .
  Fly   196 IITSMLF-------GELNVMGELMMHLNARYIQLG--QDLRRSAQMLLKKSSSLNVAIAYRLNLT 251

  Fly   261 HIADKYRPL--------------IFLQFFLSALQICFIGFQVADLFPNP--QSLYFIAFVGSLLI 309
            ||..:...|              ||:.|..||..:|.:.|:.   |.||  ...|.:.|:...: 
  Fly   252 HILRRNAALRDFGQRVEKEFTLRIFVMFAFSAGLLCALFFKA---FTNPWGNVAYIVWFLAKFM- 312

  Fly   310 ALFIYSKCGENIKSASLDFGNGLYETNWTDF---------SPPTKRALLIAAMRAQRPCQMKGY- 364
            .|......|..:...:.:.|...|..:|...         :....:.:.:|.....||..:.|. 
  Fly   313 ELLALGMLGSILLKTTDELGMMYYTADWEQVIHQSDNVGENVKLMKLVTLAIQLNSRPFFITGLN 377

  Fly   365 FFEASMATFSTIVRSAVSYIMMLRS 389
            :|..|:.....|::.|.||...|.|
  Fly   378 YFRVSLTAVLKIIQGAFSYFTFLNS 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 69/358 (19%)
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 68/349 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465690
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.