DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or9a and Or67d

DIOPT Version :9

Sequence 1:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster


Alignment Length:427 Identity:84/427 - (19%)
Similarity:161/427 - (37%) Gaps:80/427 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VKGKKQEEKDQSLRVQILVYRCMGI---DLWSPTMANDRP-WLTFVTMGPLFLFMVPMFLAAHEY 65
            :|..|.|..::..:|..::..|:|.   |:..|   |.|. |||:..|.     .:..|.|...|
  Fly     2 LKMAKVEPVERYCKVIRMIRFCVGFCGNDVADP---NFRMWWLTYAVMA-----AIAFFFACTGY 58

  Fly    66 ITQV--------SLLSDTLGSTFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDARE 122
            ...|        :::...|....:::..|.|.|:...:..       |:|.:.....:::   ||
  Fly    59 TIYVGVVINGDLTIILQALAMVGSAVQGLTKLLVTANNAS-------HMREVQNTYEDIY---RE 113

  Fly   123 I----IEVENQSDQMLSLTYTRCFGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPYDLQV 183
            .    .|.....::.:.:|:|...|...::..|   :|::::.   ...:|.:.|..|.     |
  Fly   114 YGSKGDEYAKCLEKRIRITWTLLIGFMLVYIIL---LGLVITF---PIFYLLILHQKVL-----V 167

  Fly   184 VMFYVPTYLWNVMASYSAVTMALCV------------DSLLFFFTYNVCAI-----FKIAKHRMI 231
            :.|.:|.........:..:|.|..:            |..||.|..:|..|     .|:.:...:
  Fly   168 MQFLIPFLDHTTDGGHLILTAAHVILITFGGFGNYGGDMYLFLFVTHVPLIKDIFCVKLTEFNEL 232

  Fly   232 HLPAVGGKEELEGLVQVLLLHQKGLQIADHIADKYRPLIFLQFFLSAL-QICFIGFQVADLFPNP 295
            .:......:....|..:|:.||...::.......|..::|:|...:.: .:|.|.......:| .
  Fly   233 VMKRNDFPKVRAMLCDLLVWHQLYTRMLQTTKKIYSIVLFVQLSTTCVGLLCTISCIFMKAWP-A 296

  Fly   296 QSLYFIAFVGSLLIALFIYSKCGEN--IKSASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQRP 358
            ..||.      |..|:.:|:.||..  :::::.||.:.:| ||...:..|.|...||..|.|:  
  Fly   297 APLYL------LYAAITLYTFCGLGTLVENSNEDFLSVIY-TNCLWYELPVKEEKLIIMMLAK-- 352

  Fly   359 CQMKGYFFEASMATFS-----TIVRSAVSYIMMLRSF 390
            .|.:.....|.||..|     .:.:...|:.|||.::
  Fly   353 AQNEVVLTAADMAPLSMNTALQLTKGIYSFSMMLMNY 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 63/349 (18%)
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 62/341 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.