DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or9a and Or67b

DIOPT Version :9

Sequence 1:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster


Alignment Length:274 Identity:46/274 - (16%)
Similarity:113/274 - (41%) Gaps:47/274 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 IFAALKPFVGIILSSIRGDE--IHLELPHNGVYPYDLQVVMFYVPTY-----------LWNVMAS 198
            ::..::|:...|......|:  ..:.|.:..:.|| ||:..:..|:|           ||...|.
  Fly   164 LYYCVRPYFQYIFDCYIKDKDTCEMTLTYPAIVPY-LQLGNYEFPSYVIRFFLLQSGPLWCFFAV 227

  Fly   199 YSAVTMALCVDSLLFFFTYNVCAIFKIAKHRM------IHLPAVGGKEELEGLVQVLLLHQKGLQ 257
            :.       .:||....|.....:.|:.:..:      |.:|.....:.|:..|::.      .:
  Fly   228 FG-------FNSLFVVLTRYESGLIKVLRFLVQNSTSDILVPKDQRVKYLQCCVRLF------AR 279

  Fly   258 IADH---IADKYRPLIFLQFFLSALQICFIGFQVAD------LFPNPQSLYFIAFVGSLLIALFI 313
            |:.|   |.:.::.:|.:|..:|::.||.:.::::.      ::.....:||:    ::.:.:.:
  Fly   280 ISSHHNQIENLFKYIILVQCSVSSILICMLLYKISTVLEVGWVWMGMIMVYFV----TIALEITL 340

  Fly   314 YSKCGENIKSASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQRPCQMK-GYFFEASMATFSTIV 377
            |:...:.::|.|....:..|..:|.:.|...|..:.:..:.::|...:. |.|...|......:.
  Fly   341 YNVSAQKVESQSELLFHDWYNCSWYNESREFKFMIKMMLLFSRRTFVLSVGGFTSLSHKFLVQVF 405

  Fly   378 RSAVSYIMMLRSFN 391
            |.:.::.::||:.|
  Fly   406 RLSANFFLLLRNMN 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 43/262 (16%)
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 39/228 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465071
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.